![Immunocytochemistry/Immunofluorescence: HRD1 Antibody [NBP1-89667] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89667-img0008.jpg "Immunocytochemistry/Immunofluorescence: HRD1 Antibody [NBP1-89667] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT |
| Predicted Species | Mouse (92%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYVN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89667 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Research Areas for HRD1 Antibody (NBP1-89667)Find related products by research area.
|
|
OS9: Taking proteins to the ER finish line The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYVN1 |
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human lymph node.](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0014.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0002.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells")
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0009.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0010.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human tonsil shows high expression.")
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining in human tonsil and skeletal muscle tissues using anti-SYVN1 antibody. Corresponding SYVN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0011.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining in human tonsil and skeletal muscle tissues using anti-SYVN1 antibody. Corresponding SYVN1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-SYVN1 antibody NBP1-89667 (A) shows similar protein distribution across tissues to independent antibody NBP1-89668 (B).](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0012.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-SYVN1 antibody NBP1-89667 (A) shows similar protein distribution across tissues to independent antibody NBP1-89668 (B).")
![Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/HRD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89667-img0013.jpg "Immunohistochemistry-Paraffin: HRD1 Antibody [NBP1-89667] - Staining of human cerebral cortex.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")