Home » HLA DQB2 » HLA DQB2 Proteins » HLA DQB2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HLA DQB2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HLA DQB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HLA DQB2

Source: E. coli

Amino Acid Sequence: GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HLA-DQB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17054.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HLA DQB2 Recombinant Protein Antigen

  • class II, DQ beta 1
  • DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB))
  • HLA-DQB1
  • major histocompatibility complex, class II, DQ beta 2

Background

HLA-DQB2( AAH31995, 1 a.a. - 232 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
HLA DRB1 Antibody
(SPM288)
NBP2-45312
Immunohistochemistry-Paraffin HLA DRB1 Antibody (SPM288)
Flow Cytometry HLA DRB1 Antibody (SPM288)
Immunofluorescence HLA DRB1 Antibody (SPM288)
(2 Publications)
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HLA DRB5 Antibody
NBP2-14093
Immunohistochemistry-Paraffin HLA DRB5 Antibody
Western Blot HLA DRB5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
HLA DRB3 Antibody
(Bra30)
NBP3-07168
HLA DRB3 Antibody (Bra30)
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA HLA B Antibody (2G7B10) - BSA Free
Flow Cytometry HLA B Antibody (2G7B10) - BSA Free
Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
HLA DPB1 Antibody
NBP1-89688
Immunohistochemistry-Paraffin HLA DPB1 Antibody
Immunohistochemistry-Paraffin HLA DPB1 Antibody
Immunohistochemistry-Paraffin HLA DPB1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
HLA ABC Antibody
(W6/32)
NB100-64775
Flow Cytometry HLA ABC Antibody (W6/32)
Flow Cytometry HLA ABC Antibody (W6/32)
Immunohistochemistry-Frozen HLA ABC Antibody (W6/32)
(2 Reviews)
(29 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
HLA C Antibody
(DT-9) - BSA Free
NBP2-50419
HLA C Antibody (DT-9) - BSA Free
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IP
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TRAILR1/TNFRSF10A
Antibody [Unconjugate ...
AF347
Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]
Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]
Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]
(38 Publications)
Species: Hu
Applications: IHC, Neut, WB
GAD2/GAD65
Antibody [Unconjugate
AF2247
Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
SEC14L2 Antibody
(OTI4H2)
NBP2-01346
Flow Cytometry SEC14L2 Antibody (OTI4H2)
Western Blot SEC14L2 Antibody (OTI4H2)
Immunohistochemistry-Paraffin SEC14L2 Antibody (OTI4H2)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PTGDR Antibody
H00005729-B01P
Western Blot PTGDR Antibody
Flow Cytometry PTGDR Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, WB
Desmoplakin
Antibody
NBP2-48836
Immunohistochemistry-Paraffin Desmoplakin Antibody
Immunohistochemistry-Paraffin Desmoplakin Antibody
Immunohistochemistry-Paraffin Desmoplakin Antibody
(2 Publications)
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
HLA DQB2
Recombinant Protein A
NBP3-17054PEP
HLA DQB2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP) (0)

There are no publications for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP) (0)

There are no reviews for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DQB2 Products

Research Areas for HLA DQB2 Recombinant Protein Antigen (NBP3-17054PEP)

Find related products by research area.

Blogs on HLA DQB2

There are no specific blogs for HLA DQB2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HLA DQB2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HLA-DQB2