![Immunocytochemistry/Immunofluorescence: HJURP Antibody [NBP1-85025] - Staining of human cell line A-431 shows positivity in nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/HJURP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85025-img0004.jpg "Immunocytochemistry/Immunofluorescence: HJURP Antibody [NBP1-85025] - Staining of human cell line A-431 shows positivity in nucleus & nucleoli. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HJURP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Block_Neutralize_1519.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_22159.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_6888.jpg)
![Immunocytochemistry/ Immunofluorescence Histone H4 [ac Lys5] Antibody - BSA Free](https://images.novusbio.com/images/Histone-H4-[ac--Lys5]-Antibody-Immunocytochemistry-Immunofluorescence-NB21-2024-img0007.jpg)
![Chromatin Immunoprecipitation Histone H4 [ac Lys5] Antibody - BSA Free](https://images.novusbio.com/images/Histone-H4-[ac--Lys5]-Antibody-Chromatin-Immunoprecipitation-NB21-2024-img0008.jpg)
![Western Blot Histone H4 [ac Lys5] Antibody - BSA Free](https://images.novusbio.com/images/Histone-H4-[ac--Lys5]-Antibody-Western-Blot-NB21-2024-img0009.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HJURP |
![Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human testis shows moderate to strong nuclear positivity in some spermatogonia cells.](http://images.novusbio.com/fullsize/HJURP-Antibody-Immunohistochemistry-Paraffin-NBP1-85025-img0016.jpg "Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human testis shows moderate to strong nuclear positivity in some spermatogonia cells.")
![Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/HJURP-Antibody-Immunohistochemistry-Paraffin-NBP1-85025-img0013.jpg "Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human skin shows moderate nuclear positivity in a subset of basal cells in squamous epithelium.](http://images.novusbio.com/fullsize/HJURP-Antibody-Immunohistochemistry-Paraffin-NBP1-85025-img0014.jpg "Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human skin shows moderate nuclear positivity in a subset of basal cells in squamous epithelium.")
![Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human stomach shows moderate nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/HJURP-Antibody-Immunohistochemistry-Paraffin-NBP1-85025-img0015.jpg "Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human stomach shows moderate nuclear positivity in lymphoid cells.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")