![Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Validation of anti-PPIP5K2 and anti-PPIP5K1 antibodies specific in vitro. (A) Anti-PPIP5K2 antibody immunofluorescence signal coincides with the signal produced by GFP-tagged WT PPIP5K2, and p.Arg837His variant harboring PPIP5K2 expressed in COS7 cells. (B) The anti-PPIP5K1 antibody immunofluorescence signal coincides with the GFP-tagged PPIP5K1 signal, but not with fluorescently tagged PPIP5K2 expressed in COS7 cells. (C) Western blot tested indicated the specific bands of sizes that correspond to full-length PPIP5K2 around 140 kDa. (D) Western blot on whole protein lysates from mice tissues with specific variants. Citation: Yousaf R, Gu C, Ahmed ZM, Khan SN, Friedman TB, Riazuddin S, et al. (2018) Mutations in Diphosphoinositol-Pentakisphosphate Kinase PPIP5K2 are associated with hearing loss in human and mouse. PLoS Genet 14(3): e1007297](http://images.novusbio.com/fullsize/HISPPD2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89693-img0006.jpg "Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Validation of anti-PPIP5K2 and anti-PPIP5K1 antibodies specific in vitro. (A) Anti-PPIP5K2 antibody immunofluorescence signal coincides with the signal produced by GFP-tagged WT PPIP5K2, and p.Arg837His variant harboring PPIP5K2 expressed in COS7 cells. (B) The anti-PPIP5K1 antibody immunofluorescence signal coincides with the GFP-tagged PPIP5K1 signal, but not with fluorescently tagged PPIP5K2 expressed in COS7 cells. (C) Western blot tested indicated the specific bands of sizes that correspond to full-length PPIP5K2 around 140 kDa. (D) Western blot on whole protein lysates from mice tissues with specific variants. Citation: Yousaf R, Gu C, Ahmed ZM, Khan SN, Friedman TB, Riazuddin S, et al. (2018) Mutations in Diphosphoinositol-Pentakisphosphate Kinase PPIP5K2 are associated with hearing loss in human and mouse. PLoS Genet 14(3): e1007297")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPIP5K1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPIP5K1 |
![Immunohistochemistry-Paraffin: HISPPD2A Antibody [NBP1-89693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/HISPPD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-89693-img0002.jpg "Immunohistochemistry-Paraffin: HISPPD2A Antibody [NBP1-89693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.")
![Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize/HISPPD2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89693-img0004.jpg "Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.")
![Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - HISPPD2A/PPIP5K1 antibody was used at 1:200 dilution for localizing PPIP5K2 protein in sensory and non-sensory cells of mouse inner ear using confocal microscopy analysis. Figure A shows the real-time PCR expression of Ppip5k2 in adult (P150) mice, normalized against Gapdh (Delta CT) and Ppip5k1 expression (Delta CT). In Figure B, a cross-section through one of the coils of inner ear shows diffuse cytoplasmic immunolabeling of PPIP5K2 throughout the cochlear duct, including spiral ganglion neurons (SG), organ of Corti (OC), and stria vascularis (SV). Figure C shows the expression of PPIP5K2 at the ages tested in WT mice, from early postnatal day P16, up to 9 months of age. Scale bars: 100um (panel A), and 20um (panel C).](http://images.novusbio.com/fullsize/HISPPD2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89693-img0005.jpg "Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - HISPPD2A/PPIP5K1 antibody was used at 1:200 dilution for localizing PPIP5K2 protein in sensory and non-sensory cells of mouse inner ear using confocal microscopy analysis. Figure A shows the real-time PCR expression of Ppip5k2 in adult (P150) mice, normalized against Gapdh (Delta CT) and Ppip5k1 expression (Delta CT). In Figure B, a cross-section through one of the coils of inner ear shows diffuse cytoplasmic immunolabeling of PPIP5K2 throughout the cochlear duct, including spiral ganglion neurons (SG), organ of Corti (OC), and stria vascularis (SV). Figure C shows the expression of PPIP5K2 at the ages tested in WT mice, from early postnatal day P16, up to 9 months of age. Scale bars: 100um (panel A), and 20um (panel C).")
![Western Blot PACAP/ADCYAP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PACAP_AF6380_Western_Blot_10225.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")