Home » Hippocalcin » Hippocalcin Proteins » Recombinant Human Hippocalcin GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Hippocalcin GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Hippocalcin GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-193 of Human HPCA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HPCA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
46.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hippocalcin GST (N-Term) Protein

  • BDR2
  • Calcium-binding protein BDR-2
  • hippocalcin
  • neuron specific calcium-binding protein hippocalcin
  • neuron-specific calcium-binding protein hippocalcin

Background

The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species. HPCA( NP_002134, 1 a.a. - 194 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recoverin Antibody
NBP3-38258
Immunohistochemistry Recoverin Antibody
Immunocytochemistry/ Immunofluorescence Recoverin Antibody
Immunohistochemistry Recoverin Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
GRK1 Antibody
NBP2-55226
Immunohistochemistry-Paraffin GRK1 Antibody
Immunohistochemistry-Paraffin GRK1 Antibody
Immunohistochemistry-Paraffin GRK1 Antibody
(1 Publication)
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
Arrestin 3 Antibody
NBP1-37003
Immunohistochemistry-Paraffin Arrestin 3 Antibody
Immunohistochemistry-Paraffin Arrestin 3 Antibody
(9 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Protein Kinase A
regulatory subunit I ...
NBP1-47935
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Western Blot Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CXADR Antibody
[Unconjugated]
AF2654
Western Blot CXADR Antibody [Unconjugated]
Simple Western CXADR Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
TRIM13 Antibody
NBP1-85016
Western Blot TRIM13 Antibody
Immunohistochemistry-Paraffin TRIM13 Antibody
Immunohistochemistry-Paraffin TRIM13 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
(1 Review)
(21 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SPG7 Antibody
(OTI1C1)
NBP2-01860
Western Blot SPG7 Antibody (OTI1C1)
Flow Cytometry SPG7 Antibody (OTI1C1)
Flow Cytometry SPG7 Antibody (OTI1C1)
(1 Review)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
visinin-like 1
Antibody (3A9)
NBP2-25167
Western Blot visinin-like 1 Antibody (3A9)
Immunocytochemistry/ Immunofluorescence visinin-like 1 Antibody (3A9)
Western Blot visinin-like 1 Antibody (3A9)
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NAIP Antibody -
BSA Free
NBP1-77196
Immunocytochemistry NAIP Antibody - BSA Free
Immunofluorescence NAIP Antibody - BSA Free
Western Blot NAIP Antibody - BSA Free
(1 Publication)
Species: Ec, Hu
Applications: ELISA, ICC/IF, IM, IP, PAGE, WB
Recombinant Human
Hippocalcin GST (N-Te ...
H00003208-P01
Recombinant Human Hippocalcin GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Hippocalcin Recombinant Protein (H00003208-P01) (0)

There are no publications for Hippocalcin Recombinant Protein (H00003208-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hippocalcin Recombinant Protein (H00003208-P01) (0)

There are no reviews for Hippocalcin Recombinant Protein (H00003208-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hippocalcin Recombinant Protein (H00003208-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hippocalcin Products

Research Areas for Hippocalcin Recombinant Protein (H00003208-P01)

Find related products by research area.

Blogs on Hippocalcin

There are no specific blogs for Hippocalcin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Total protein from human Hek293 and rat Pancreas was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CaSR in block buffer and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
NB120-19347
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of different tissue lysates and recombinant protein solutions using chicken pAb to calbindin, NBP2-50028, dilution 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] pig hippocampus, [4] cow cerebellum, [5] protein standard (red). Next lanes are full length recombinant human proteins, [6] Parvalbumin, [7] Calretinin, [8] Calbindin. Bands at 25kDa in tissue lysates and ~30 kDa in protein solutions correspond to calbindin, the recombinant form being slightly larger due to the presence of a His tag and other vector derived sequence. NBP2-50028 antibody specifically recognizes calbindin protein and does not react with the closely related proteins parvalbumin and calretinin.
Calbindin D-28K Antibody
NBP2-50028

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hippocalcin GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol HPCA