Novus Biologicals products are now on bio-techne.com

HBS1L Recombinant Protein Antigen

Name: HBS1L Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85124PEP
Price: 289 USD

Images

There are currently no images for HBS1L Protein (NBP1-85124PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

HBS1L Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HBS1L. Source: E. coli Amino Acid Sequence: CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	HBS1L
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85124. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HBS1L Recombinant Protein Antigen

DKFZp434g247
ERF3-similar protein
ERFSDKFZp686L13262
HBS1 (S. cerevisiae)-like
HBS1KIAA1038EF-1a
HBS1-like (S. cerevisiae)
HBS1-like protein
Hsp70 subfamily B suppressor 1-like protein
HSPC276

Background

HBS1L encodes a member of the GTP-binding elongation factor family. It is expressed in multiple tissues with the highest expression in heart and skeletal muscle. The intergenic region of this gene and the MYB gene has been identified to be a quantitative trait locus (QTL) controlling fetal hemoglobin level, and this region influnces erythrocyte, platelet, and monocyte counts as well as erythrocyte volume and hemoglobin content. DNA polymorphisms at this region associate with fetal hemoglobin levels and pain crises in sickle cell disease. A single nucleotide polymorphism in exon 1 of this gene is significantly associated with severity in beta-thalassemia/Hemoglobin E. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

eRF1 Antibody -
BSA Free

NBP1-31113

Immunocytochemistry/ Immunofluorescence eRF1 Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ZFP36L1 Antibody

NBP2-86906

Species: Hu

Applications: IHC, IHC-P, WB

AP-2 gamma
Antibody [Unconjugate

AF5059

Immunohistochemistry AP-2 gamma Antibody [Unconjugated]

(11 Publications)

Species: Hu

Applications: IHC, WB

eEF1A1 Antibody -
Azide and BSA Free

NBP2-92880

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

c-Myb Antibody -
BSA Free

NBP1-80306

Immunohistochemistry-Paraffin c-Myb Antibody - BSA Free

(1 Review)

(2 Publications)

Species: Av, Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

GDI1 Antibody -
BSA Free

NBP1-31528

Immunohistochemistry-Paraffin GDI1 Antibody - BSA Free

Species: Hu, Mu

Applications: IHC, IHC-P, WB

NGDN Antibody
(OTI1H4)

NBP2-46162

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

ABCE1 Antibody -
BSA Free

NB400-116

Immunocytochemistry/ Immunofluorescence ABCE1 Antibody - BSA Free

(6 Publications)

Species: Hu, Pm

Applications: ICC/IF, IP, WB

AHI1 Antibody -
BSA Free

NBP1-78206

Species: Hu

Applications: IP, WB

eEF-2 Antibody
(4E2Z5)

NBP3-16866

Immunocytochemistry/ Immunofluorescence eEF-2 Antibody (4E2Z5)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

beta
2-Microglobulin Antib ...

NB500-317

Flow Cytometry beta 2-Microglobulin Antibody (B2M-01) - BSA Free

ELISA beta 2-Microglobulin Antibody (B2M-01) - BSA Free

(1 Review)

(3 Publications)

Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB

HspA4 Antibody -
BSA Free

NBP1-81696

Immunohistochemistry-Paraffin HspA4 Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ALDH8A1 Antibody -
BSA Free

NBP2-38753

Species: Hu

Applications: ICC/IF, IHC, IHC-P

UBE4A Antibody
(1G8) - Azide and BSA ...

H00009354-M08

Immunocytochemistry/ Immunofluorescence UBE4A Antibody (1G8) - Azide and BSA Free

Western Blot UBE4A Antibody (1G8) - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

GAPDH Antibody
(1D4) - BSA Free

NB300-221

Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4) - BSA Free

(19 Reviews)

(448 Publications)

Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze

Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB

SPOP Antibody -
Azide and BSA Free

H00008405-B01P

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

SPSB1 Antibody

NBP2-86827

Species: Hu

Applications: WB

TEAD1 Antibody -
Azide and BSA Free

NBP2-94035

Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free

Western Blot TEAD1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB

Publications for HBS1L Protein (NBP1-85124PEP) (0)

There are no publications for HBS1L Protein (NBP1-85124PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBS1L Protein (NBP1-85124PEP) (0)

There are no reviews for HBS1L Protein (NBP1-85124PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HBS1L Protein (NBP1-85124PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HBS1L Products

Research Areas for HBS1L Protein (NBP1-85124PEP)

Find related products by research area.

Signal Transduction

Blogs on HBS1L

There are no specific blogs for HBS1L, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.

GAPDH Antibody (1D4) - BSA Free
NB300-221

Western Blot: beta 2-Microglobulin Antibody (B2M-01) [NB500-317] - Analysis using the FITC conjugate of NB500-317. Detection (non-reducing conditions) of whole cell lysate of various cell lines Lane 1: RAJI human Burkitt lymphoma cell line Lane 2: EL4 mouse lymphoblastic lymphoma cell line Lane 3: U937 human histiocytic lymphoma cell line.

beta 2-Microglobulin Antibody (B2M-01) - BSA Free
NB500-317

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our HBS1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

HBS1L

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HBS1L Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

HBS1L Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for HBS1L Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HBS1L Protein (NBP1-85124PEP) (0)

Reviews for HBS1L Protein (NBP1-85124PEP) (0)

FAQs for HBS1L Protein (NBP1-85124PEP) (0)

Additional HBS1L Products

Research Areas for HBS1L Protein (NBP1-85124PEP)

Blogs on HBS1L

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics