Home » gp130/CD130 » gp130/CD130 Proteins » gp130/CD130 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

gp130/CD130 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

gp130/CD130 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL6ST.

Source: E. coli

Amino Acid Sequence: CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL6ST
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88138.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for gp130/CD130 Recombinant Protein Antigen

  • CD130 antigen
  • CD130
  • CDw130
  • DKFZp564F053
  • gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form
  • gp130
  • IL-6 receptor subunit beta
  • IL-6R subunit beta
  • IL-6RB
  • IL-6R-beta
  • IL6ST
  • interleukin 6 signal transducer (gp130, oncostatin M receptor)
  • interleukin receptor beta chain
  • interleukin-6 receptor subunit beta
  • Interleukin-6 signal transducer
  • Membrane glycoprotein 130
  • membrane glycoprotein gp130
  • Oncostatin-M receptor subunit alpha

Background

CD130 is encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(672 Publications)
Species: Mu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
LIF [Unconjugated]
7734-LF
LIF [Unconjugated]
(32 Publications)
Species: Hu
Applications: BA
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Oncostatin M/OSM
[Unconjugated]
8475-OM/CF
Oncostatin M/OSM [Unconjugated]
(1 Publication)
Species: Hu
Applications: BA
LIFR alpha
Antibody [Unconjugate
AF-249-NA
Neutralization LIFR alpha Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: Neut, WB
CNTF [Unconjugated]
257-NT
SDS-PAGE CNTF [Unconjugated]
Bioactivity CNTF [Unconjugated]
(64 Publications)
Species: Hu
Applications: BA
IL-11 [HRP]
D1100
N/A IL-11 [HRP]
N/A IL-11 [HRP]
N/A IL-11 [HRP]
(31 Publications)
Species: Hu
Applications: ELISA
CCM2 Antibody
(OTI1E9)
NBP2-01134
Western Blot CCM2 Antibody (OTI1E9)
Immunohistochemistry-Paraffin CCM2 Antibody (OTI1E9)
Immunohistochemistry-Paraffin CCM2 Antibody (OTI1E9)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SOAT1 Antibody
NB400-141
SOAT1 Antibody
(7 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(820 Publications)
Species: Hu
Applications: BA

Cardiotrophin-1/CT-1
612-CD
Cardiotrophin-1/CT-1
(9 Publications)
Species: Hu
Applications: BA
Jak1 Antibody
(413104) [Unconjugate
MAB4260
Western Blot Jak1 Antibody (413104) [Unconjugated]
Immunohistochemistry Jak1 Antibody (413104) [Unconjugated]
Intracellular Staining by Flow Cytometry Jak1 Antibody (413104) [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
IL-6R alpha [HRP]
DR600
N/A IL-6R alpha [HRP]
N/A IL-6R alpha [HRP]
(45 Publications)
Species: Hu
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
gp130/CD130
Recombinant Protein A
NBP1-88138PEP
gp130/CD130 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP) (0)

There are no publications for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP) (0)

There are no reviews for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional gp130/CD130 Products

Research Areas for gp130/CD130 Recombinant Protein Antigen (NBP1-88138PEP)

Find related products by research area.

Blogs on gp130/CD130

There are no specific blogs for gp130/CD130, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our gp130/CD130 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IL6ST