Home » GOT2 » GOT2 Proteins » GOT2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GOT2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GOT2 Protein (NBP1-81565PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

GOT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOT2.

Source: E. coli

Amino Acid Sequence: GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81565.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GOT2 Recombinant Protein Antigen

  • aspartate aminotransferase, mitochondrial
  • EC 2.6.1
  • EC 2.6.1.1
  • FABP-1
  • FABPpm
  • Fatty acid-binding protein
  • FLJ40994
  • Glutamate oxaloacetate transaminase 2
  • glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase2)
  • KAT4
  • KATIV
  • kynurenine aminotransferase IV
  • mAspAT
  • mitAAT
  • Plasma membrane-associated fatty acid-binding protein
  • Transaminase A

Background

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FABP7/B-FABP
Antibody [Unconjugate
AF3166
Immunohistochemistry FABP7/B-FABP Antibody [Unconjugated]
Simple Western FABP7/B-FABP Antibody [Unconjugated]
Western Blot FABP7/B-FABP Antibody [Unconjugated]
(2 Reviews)
(15 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
FABP1/L-FABP
Antibody - BSA Free
NBP1-87695
Western Blot FABP1/L-FABP Antibody - BSA Free
Immunohistochemistry-Paraffin FABP1/L-FABP Antibody - BSA Free
Immunohistochemistry-Paraffin FABP1/L-FABP Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(136 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FABP5/E-FABP
Antibody [Unconjugate
AF1476
Western Blot FABP5/E-FABP Antibody [Unconjugated]
Knockout Validated FABP5/E-FABP Antibody [Unconjugated]
Immunohistochemistry FABP5/E-FABP Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
FATP1/SLC27A1
Antibody (308420) [Un ...
MAB3304
Immunocytochemistry FATP1/SLC27A1 Antibody (308420) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(55 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
FABP4/A-FABP
Antibody [Unconjugate
AF1443
Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]
Western Blot FABP4/A-FABP Antibody [Unconjugated]
Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]
(2 Reviews)
(41 Publications)
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
FABP3/H-FABP
Antibody (242305) [Un ...
MAB1678
Western Blot FABP3/H-FABP Antibody (242305) [Unconjugated]
Immunohistochemistry FABP3/H-FABP Antibody (242305) [Unconjugated]
Simple Western FABP3/H-FABP Antibody (242305) [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(43 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
FACA/FANCA Antibody
NB100-2564
Western Blot FACA/FANCA Antibody
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
GTF3A Antibody -
BSA Free
NBP2-04017
Western Blot GTF3A Antibody - BSA Free
Species: Hu
Applications: IP, WB
CS Citrate
Synthase Antibody (17 ...
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761) - Azide and BSA Free
Western Blot CS Citrate Synthase Antibody (1761) - Azide and BSA Free
Western Blot CS Citrate Synthase Antibody (1761) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA

Publications for GOT2 Protein (NBP1-81565PEP) (0)

There are no publications for GOT2 Protein (NBP1-81565PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOT2 Protein (NBP1-81565PEP) (0)

There are no reviews for GOT2 Protein (NBP1-81565PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GOT2 Protein (NBP1-81565PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GOT2 Products

Research Areas for GOT2 Protein (NBP1-81565PEP)

Find related products by research area.

Blogs on GOT2

There are no specific blogs for GOT2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: CD36 Antibody [NB400-144] - Mouse primary muscle cell lysate. Western blot image submitted by a verified customer review.
CD36 Antibody - BSA Free
NB400-144

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GOT2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GOT2