GNA14 Antibody Summary
Immunogen |
GNA14 (NP_004288.1, 1 a.a. - 355 a.a.) full-length human protein. MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
GNA14 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GNA14 Antibody
Background
GNA14, also known as Guanine nucleotide-binding protein subunit alpha-14, is a 355 amino acid that is 42 kDa, engaged as modulator or transducer in various transmembrane signaling systems. Disease research is currently being studied with relation to GNA14 and acanthocytosis fainting, chorea, pertussis, chagas disease, trypanosomiasis, thrombosis, hypertension, hypertension, susceptibility to neuronitis, neuroblastoma, and pancreatitis. This protein has been linked to many pathways such as development activation of ERK by Alpha-1 adrenergic receptors, molecular mechanisms of cancer, intracellular calcium signaling, visual cycle in retinal rods, CDK5 pathway, ERK5 signaling, GPCR downstream signaling, hemostasis, gastrin-CREB signalling pathway via PKC and MAPK, signaling by GPCR, signal amplification, Chagas disease (American trypanosomiasis), and amoebiasis pathways where it interacts with approx. 700 proteins including OPRL1, CHRM2, CCR1, CXCR1, and CXCR2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for GNA14 Antibody (H00009630-B01P-50ug) (0)
There are no publications for GNA14 Antibody (H00009630-B01P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GNA14 Antibody (H00009630-B01P-50ug) (0)
There are no reviews for GNA14 Antibody (H00009630-B01P-50ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GNA14 Antibody (H00009630-B01P-50ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GNA14 Products
Array H00009630-B01P-50ug
Research Areas for GNA14 Antibody (H00009630-B01P-50ug)
Find related products by research area.
|
Blogs on GNA14