Home » GLMN » GLMN Proteins » GLMN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GLMN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GLMN Protein (NBP2-14056PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GLMN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLMN.

Source: E. coli

Amino Acid Sequence: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLMN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14056.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLMN Recombinant Protein Antigen

  • FAP
  • FAP48FAP68
  • FKBPAP
  • GLMLFK506-binding protein-associated protein
  • glomulin
  • glomulin, FKBP associated protein
  • GVM
  • GVMFKBP-associated protein
  • VMGLOMvenous malformation with glomus cells

Background

GLMN encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Coagulation Factor
XIV/Protein C Antibod ...
NBP1-86509
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
DPPIV/CD26
Antibody [Unconjugate
AF1180
Simple Western DPPIV/CD26 Antibody [Unconjugated]
Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]
Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]
(2 Reviews)
(55 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MSH2 Antibody
(MSH2/2622)
NBP3-07211
Flow Cytometry MSH2 Antibody (MSH2/2622)
Immunocytochemistry/ Immunofluorescence MSH2 Antibody (MSH2/2622)
Immunohistochemistry-Paraffin MSH2 Antibody (MSH2/2622)
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry MLH1 Antibody (SP08-04)
Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)
Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
MYH Antibody (4D10)
H00004595-M01
Western Blot MYH Antibody (4D10)
Knockdown Validated MYH Antibody (4D10)
Western Blot MYH Antibody (4D10)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
DPP8 Antibody
(OTI1D2)
NBP2-01830
Western Blot DPP8 Antibody (OTI1D2)
Immunohistochemistry-Paraffin DPP8 Antibody (OTI1D2)
Western Blot DPP8 Antibody (OTI1D2)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DPP9 Antibody
(OTI2E3)
NBP2-01521
Flow Cytometry DPP9 Antibody (OTI2E3)
Western Blot DPP9 Antibody (OTI2E3)
Immunohistochemistry-Paraffin DPP9 Antibody (OTI2E3)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
GLMN Recombinant
Protein Antigen
NBP2-14056PEP
GLMN Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for GLMN Protein (NBP2-14056PEP) (0)

There are no publications for GLMN Protein (NBP2-14056PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLMN Protein (NBP2-14056PEP) (0)

There are no reviews for GLMN Protein (NBP2-14056PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLMN Protein (NBP2-14056PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLMN Products

Research Areas for GLMN Protein (NBP2-14056PEP)

Find related products by research area.

Blogs on GLMN

There are no specific blogs for GLMN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of LoVo human colorectal adenocarcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for DPPIV/CD26 at approximately 168 kDa (as indicated) using 2 µg/mL of Goat Anti-Human DPPIV/CD26 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1180) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
DPPIV/CD26 Antibody [Unconjugated]
AF1180

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLMN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GLMN