![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0015.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GCN1L1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GCN1L1 |
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0004.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0005.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0006.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining in human testis and liver tissues using anti-GCN1 antibody. Corresponding GCN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0007.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining in human testis and liver tissues using anti-GCN1 antibody. Corresponding GCN1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0009.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human colon.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0010.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human colon.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human skeletal muscle, skin, stomach and testis using Anti-GCN1L1 antibody NBP1-83381 (A) shows similar protein distribution across tissues to independent antibody NBP1-83383 (B).](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0011.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human skeletal muscle, skin, stomach and testis using Anti-GCN1L1 antibody NBP1-83381 (A) shows similar protein distribution across tissues to independent antibody NBP1-83383 (B).")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0012.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0013.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GCN1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-83381-img0014.jpg "Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Western Blot GCN2 [p Thr899] Antibody](https://images.novusbio.com/images2/GCN2_AF7605_Western_Blot_12440.jpg)
![Western Blot ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0004.jpg)
![Immunohistochemistry-Paraffin ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Immunohistochemistry-NB100-81798-img0003.jpg)
![Western Blot ATF2 [p Thr69] Antibody](https://images.novusbio.com/images/ATF2-[p-Thr69]-Antibody-Western-Blot-NB100-81798-img0001.jpg)
![Immunocytochemistry CRY1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CRY1_AF3764_Immunocytochemistry__Immunofluorescence_19530.jpg)
![Immunohistochemistry CRY1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3764_human-mouse-cry1-affinity-purified-polyclonal-ab-immunohistochemistry-16122024132946..jpg)
![Immunohistochemistry CRY1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3764_human-mouse-cry1-affinity-purified-polyclonal-ab-immunohistochemistry-16122024133047..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")