GATA-6 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATA-6. Source: E. coli Amino Acid Sequence: INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
GATA6 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55937. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GATA-6 Recombinant Protein Antigen
Background
The Gata6 gene is a transcriptional activator that is crucial to modulating terminal differentiation and/or proliferation by regulating SEMA3C and PLXNA2. The Gata6 gene is most prominent during vertebrate development in early and later embryogenesis. Two isoforms exist: isoform 1 is 595 amino acids long at 60 kDa and isoform 2 exists at 449 amino acids in length and 45 kDA. The Gata6 gene focuses on endo- and mesodermally derived cells, thus participating significantly in gut, lung, and heart development and mutations of the Gata6 gene are linked to multiple congenital defects. The Gata6 gene has also been associated with polycystic ovary syndrome, hernias, teratoma, pulmonary fibrosis, germ cell tumor, gastric cancer, Crohn's disease, colorectal cancer, colon cancer, and carcinoma. It is known to interact with KLF13, MED1, HHEX, KLF2, and SP1 as it functions in pathways such as lymphocyte signaling, heart development, hemostasis, and thrombin signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: AC
Publications for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP) (0)
There are no publications for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP) (0)
There are no reviews for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP) (0)
Additional GATA-6 Products
Research Areas for GATA-6 Recombinant Protein Antigen (NBP2-55937PEP)
Find related products by research area.
|
Blogs on GATA-6