Home » Galectin-3 » Galectin-3 Proteins » Galectin-3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Galectin-3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Galectin-3 Protein (NBP1-89795PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Galectin-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGALS3.

Source: E. coli

Amino Acid Sequence: SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGALS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89795.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Galectin-3 Recombinant Protein Antigen

  • AGE-R3
  • Carbohydrate-binding protein 35
  • CBP 35,35 kDa lectin
  • CBP35
  • GAL3
  • Gal-3
  • galactin-3
  • Galactose-specific lectin 3
  • Galactoside-binding protein
  • GALBPCBP35
  • Galectin3
  • Galectin-3
  • GALIG
  • IgE-binding protein
  • L29
  • L31
  • L-31
  • Laminin-binding protein
  • Lectin L-29
  • lectin, galactoside-binding, soluble, 3
  • LGALS2
  • LGALS3
  • Mac-2 antigen
  • Mac-2
  • MAC2GAL3

Background

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry Cytokeratin 19 Antibody - BSA Free
Western Blot Cytokeratin 19 Antibody - BSA Free
Immunohistochemistry Cytokeratin 19 Antibody - BSA Free
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Galanin Antibody
NBP2-33582
Immunocytochemistry/ Immunofluorescence Galanin Antibody
Immunohistochemistry-Paraffin Galanin Antibody
Immunohistochemistry-Paraffin Galanin Antibody
(1 Review)
(2 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Galectin-4
Antibody [Unconjugate
AF2128
Immunohistochemistry Galectin-4 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB
GCET2 Antibody
NBP1-82693
Western Blot GCET2 Antibody
Immunohistochemistry-Paraffin GCET2 Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Galectin 13
Antibody (PP13/1161)
NBP2-53210
Western Blot Galectin 13 Antibody (PP13/1161)
Immunohistochemistry-Paraffin Galectin 13 Antibody (PP13/1161)
Immunohistochemistry-Paraffin Galectin 13 Antibody (PP13/1161)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Galectin-7
Antibody [Unconjugate
AF1339
Western Blot Galectin-7 Antibody [Unconjugated]
Simple Western Galectin-7 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Simple Western, WB
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
Flow Cytometry MUC1 Antibody (SM3) - BSA Free
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
(14 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Galectin-3BP/MAC-2BP/L ...
AF2226
Immunocytochemistry Galectin-3BP/MAC-2BP/LGALS3BP Antibody [Unconjugated]
Western Blot Galectin-3BP/MAC-2BP/LGALS3BP Antibody [Unconjugated]
Simple Western Galectin-3BP/MAC-2BP/LGALS3BP Antibody [Unconjugated]
(2 Reviews)
(17 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
RPSA Antibody
(RPSA/2699) - Azide a ...
NBP2-79854
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
GALK1 Antibody
NBP1-81853
Western Blot GALK1 Antibody
Immunocytochemistry/ Immunofluorescence GALK1 Antibody
Western Blot GALK1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Galectin-3 Protein (NBP1-89795PEP) (0)

There are no publications for Galectin-3 Protein (NBP1-89795PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-3 Protein (NBP1-89795PEP) (0)

There are no reviews for Galectin-3 Protein (NBP1-89795PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-3 Protein (NBP1-89795PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Galectin-3 Products

Research Areas for Galectin-3 Protein (NBP1-89795PEP)

Find related products by research area.

Blogs on Galectin-3

There are no specific blogs for Galectin-3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western blot shows lysates of MCF-7 human breast cancer cell line, U-118-MG human glioblastoma/astrocytoma cell line, C6 rat glioma cell line, and NR8383 rat alveolar macrophage cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse Galectin-3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Galectin-3 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Galectin-3 Antibody [Unconjugated]
AF1197

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LGALS3