G3BP2 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human G3BP2. Peptide sequence: QRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDID The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
G3BP2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for G3BP2 Antibody
Background
Ras-GAP SH3 domain binding protein (G3BP2) contains an RNA recognition motif (RRM) and an N-terminal nuclear transport factor 2-like (NTF2-like) domain. The G3BP family of proteins have been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation.G3BP2 can interact with IkappaBalpha and IkappaBalpha/NFkappaB complexes. In this complex G3B2 is proposed to play a role in regulating the nucleocytoplasmic localization of NFkappaB as well as its activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Publications for G3BP2 Antibody (NBP2-84947) (0)
There are no publications for G3BP2 Antibody (NBP2-84947).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for G3BP2 Antibody (NBP2-84947) (0)
There are no reviews for G3BP2 Antibody (NBP2-84947).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for G3BP2 Antibody (NBP2-84947) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional G3BP2 Products
Research Areas for G3BP2 Antibody (NBP2-84947)
Find related products by research area.
|
Blogs on G3BP2