![Western Blot: FUT6 Antibody [NBP3-04778] - Analysis of extracts of SW480 cells, using FUT6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .](http://images.novusbio.com/fullsize/FUT6-Antibody-Western-Blot-NBP3-04778-img0003.jpg "Western Blot: FUT6 Antibody [NBP3-04778] - Analysis of extracts of SW480 cells, using FUT6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-359 of human FUT6 (NP_000141.1). WLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FUT6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunohistochemistry_6938.jpg)
![Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/E-Selectin_BBA16_Immunocytochemistry_9821.jpg)
![Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]](https://images.novusbio.com/images2/bba16_human-e-selectin-cd62e-mab-clone-bbig-e4-flow-cytometry-25102021144214.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for FUT6 Antibody (NBP3-04778)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FUT6 |
![Immunohistochemistry-Paraffin: FUT6 Antibody [NBP3-04778] - Paraffin-embedded human stomach using FUT6 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FUT6-Antibody-Immunohistochemistry-Paraffin-NBP3-04778-img0002.jpg "Immunohistochemistry-Paraffin: FUT6 Antibody [NBP3-04778] - Paraffin-embedded human stomach using FUT6 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: FUT6 Antibody [NBP3-04778] - Paraffin-embedded human liver using FUT6 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FUT6-Antibody-Immunohistochemistry-Paraffin-NBP3-04778-img0001.jpg "Immunohistochemistry-Paraffin: FUT6 Antibody [NBP3-04778] - Paraffin-embedded human liver using FUT6 antibody at dilution of 1:100 (40x lens).")
![Western Blot Fucosyltransferase 8/FUT8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Fucosyltransferase_8_AF5768_Western_Blot_5836.jpg)
![Simple Western Fucosyltransferase 8/FUT8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Fucosyltransferase_8_AF5768_Simple_Western_17652.jpg)
![Immunohistochemistry Fucosyltransferase 8/FUT8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Fucosyltransferase_8_AF5768_Immunohistochemistry_7199.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")