Home » FSH beta » FSH beta Proteins » Recombinant Human FSH beta GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human FSH beta GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human FSH beta Protein [H00002488-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human FSH beta Protein [H00002488-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human FSH beta GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 19-129 of Human FSH beta

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
FSHB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FSH beta GST (N-Term) Protein

  • follicle stimulating hormone, beta polypeptide
  • Follicle-stimulating hormone beta subunit
  • Follitropin beta chain
  • follitropin subunit beta
  • Follitropin
  • follitropin, beta chain
  • FSH beta
  • FSHB
  • FSH-B
  • FSH-beta

Background

The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
Mouse, Rat
Luteinizing Hormone E ...
KA2332
Mouse, Rat Luteinizing Hormone ELISA Kit (Colorimetric)
(19 Publications)
Species: Mu, Rt
Applications: ELISA, QFN
GnRHR Antibody
(F1G4)
NBP2-45298
Immunohistochemistry-Paraffin GnRHR Antibody (F1G4)
Immunocytochemistry/ Immunofluorescence GnRHR Antibody (F1G4)
Western Blot GnRHR Antibody (F1G4)
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
FSHR Antibody
(6E8.2F5) - BSA Free
NBP2-36489
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
Immunohistochemistry-Paraffin FSHR Antibody (6E8.2F5) - BSA Free
(8 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Chorionic
Gonadotropin alpha Ch ...
MAB4169
Immunohistochemistry Chorionic Gonadotropin alpha Chain (hCG alpha) Antibody (381012)
Species: Hu
Applications: IHC, WB
Follistatin [HRP]
DFN00
N/A Follistatin [HRP]
N/A Follistatin [HRP]
N/A Follistatin [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
Activin A
[Unconjugated]
338-AC
Activin A [Unconjugated]
(551 Publications)
Species: Hu, Mu, Rt
Applications: BA
Chromogranin A
Antibody - BSA Free
NB120-15160
Immunocytochemistry/ Immunofluorescence Chromogranin A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Chromogranin A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Chromogranin A Antibody - BSA Free
(2 Reviews)
(43 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(11 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
PACAP/ADCYAP1
Antibody [Unconjugate
AF6380
Western Blot PACAP/ADCYAP1 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
FOXL2 Antibody
NB100-1277
Western Blot FOXL2 Antibody
Immunohistochemistry-Paraffin FOXL2 Antibody
Immunohistochemistry-Paraffin FOXL2 Antibody
(1 Review)
(75 Publications)
Species: Bv, Ma, Hu, Mu
Applications: ChIP, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
FSH beta GST (N-Term) ...
H00002488-Q01
Recombinant Human FSH beta GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for FSH beta Partial Recombinant Protein (H00002488-Q01) (0)

There are no publications for FSH beta Partial Recombinant Protein (H00002488-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSH beta Partial Recombinant Protein (H00002488-Q01) (0)

There are no reviews for FSH beta Partial Recombinant Protein (H00002488-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSH beta Partial Recombinant Protein (H00002488-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FSH beta Products

Research Areas for FSH beta Partial Recombinant Protein (H00002488-Q01)

Find related products by research area.

Blogs on FSH beta

There are no specific blogs for FSH beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FSH beta GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol FSHB