Home » FOXA3 » FOXA3 Proteins » Recombinant Human FOXA3 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human FOXA3 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human FOXA3 Protein [H00003171-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human FOXA3 Protein [H00003171-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human FOXA3 GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-350 of Human FOXA3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
FOXA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
63.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FOXA3 GST (N-Term) Protein

  • FKHH3
  • Fork head-related protein FKH H3
  • forkhead box A3
  • Forkhead box protein A3
  • hepatocyte nuclear factor 3, gamma
  • hepatocyte nuclear factor 3-gamma
  • HNF-3G
  • HNF-3-gamma
  • HNF3GTCF-3G
  • MGC10179
  • TCF3G
  • Transcription factor 3G

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(98 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Immunoprecipitation HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/ Immunofluorescence TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
FoxM1 Antibody
AF3975
Western Blot FoxM1 Antibody
Immunocytochemistry FoxM1 Antibody
Western Blot FoxM1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
HNF-6/ONECUT1
Antibody [Unconjugate
AF6277
Immunocytochemistry HNF-6/ONECUT1 Antibody [Unconjugated]
Western Blot HNF-6/ONECUT1 Antibody [Unconjugated]
Immunocytochemistry HNF-6/ONECUT1 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Western Blot HNF-4 alpha/NR2A1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
MLX Antibody
[Unconjugated]
AF4186
Western Blot MLX Antibody [Unconjugated]
Immunocytochemistry MLX Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(90 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
SH3D19 Antibody
(5C7)
H00152503-M01
Immunocytochemistry/ Immunofluorescence SH3D19 Antibody (5C7)
Immunohistochemistry-Paraffin SH3D19 Antibody (5C7)
Western Blot SH3D19 Antibody (5C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
EBP Antibody
NBP1-85699
Immunocytochemistry/ Immunofluorescence EBP Antibody
Immunohistochemistry-Paraffin EBP Antibody
Immunohistochemistry-Paraffin EBP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IGFBP-1 [Biotin]
DY871
N/A IGFBP-1 [Biotin]
(16 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
FOXA3 GST (N-Term) Pr ...
H00003171-P01
Recombinant Human FOXA3 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for FOXA3 Recombinant Protein (H00003171-P01) (0)

There are no publications for FOXA3 Recombinant Protein (H00003171-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXA3 Recombinant Protein (H00003171-P01) (0)

There are no reviews for FOXA3 Recombinant Protein (H00003171-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXA3 Recombinant Protein (H00003171-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXA3 Products

Research Areas for FOXA3 Recombinant Protein (H00003171-P01)

Find related products by research area.

Blogs on FOXA3

There are no specific blogs for FOXA3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FOXA3 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol FOXA3