Home » FMNL3 » FMNL3 Proteins » FMNL3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FMNL3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FMNL3 Protein (NBP1-84092PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FMNL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMNL3.

Source: E. coli

Amino Acid Sequence: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FMNL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84092.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FMNL3 Recombinant Protein Antigen

  • formin-like 3

Background

FMNL3, also known as Formin-like protein 3, has 3 isoforms, a 1,028 amino acid isoform that is 117 kDs, a 976 amino acid isoform that is 111 kDa and a 1,027 amino acid isoform that is 117 kDa, plays an important role in the regulation of cell morphology and cytoskeletal organization and is required in the control of cell shape and migration. Disease research is currently being studied with relation to FMNL3 and chondrosarcoma and glioblastoma. This protein has been linked to the cytoskeleton organization, actin cytoskeleton organization, regulation of cell shape, cellular component organization, and cell migration pathways in interaction with PRPF40A and YWHAB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FMNL2 Antibody
NBP2-24748
Immunohistochemistry-Paraffin FMNL2 Antibody
Immunohistochemistry-Paraffin FMNL2 Antibody
Western Blot FMNL2 Antibody
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
FMNL1 Antibody
NBP1-88461
Immunohistochemistry-Paraffin FMNL1 Antibody
Immunohistochemistry-Paraffin FMNL1 Antibody
Immunohistochemistry-Paraffin FMNL1 Antibody
Species: Hu
Applications: IHC, IHC-P
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
FNBP3 Antibody
NBP1-87933
Western Blot FNBP3 Antibody
Immunocytochemistry/ Immunofluorescence FNBP3 Antibody
Immunohistochemistry-Paraffin FNBP3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
FHOD1 Antibody
NBP1-83900
Immunocytochemistry/ Immunofluorescence FHOD1 Antibody
Immunohistochemistry-Paraffin FHOD1 Antibody
Immunohistochemistry-Paraffin FHOD1 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DIAPH-2 Antibody
NBP1-85217
Immunohistochemistry-Paraffin DIAPH-2 Antibody
Immunohistochemistry-Paraffin DIAPH-2 Antibody
Immunohistochemistry-Paraffin DIAPH-2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GRID2IP Antibody
NBP1-94174
Western Blot GRID2IP Antibody
Species: Hu
Applications: WB
DIAPH1 Antibody
NB600-231
Immunohistochemistry-Paraffin DIAPH1 Antibody
Western Blot DIAPH1 Antibody
Western Blot DIAPH1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, KD, WB
DAAM2 Antibody
NBP2-47496
Immunocytochemistry/ Immunofluorescence DAAM2 Antibody
Immunohistochemistry-Paraffin DAAM2 Antibody
Immunohistochemistry-Paraffin DAAM2 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DAAM1 Antibody
(4H3)
H00023002-M03
ELISA DAAM1 Antibody (4H3)
Proximity Ligation Assay DAAM1 Antibody (4H3)
Western Blot DAAM1 Antibody (4H3)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
Filamin B Antibody
NBP1-90286
Immunocytochemistry/ Immunofluorescence Filamin B Antibody
Western Blot Filamin B Antibody
Immunohistochemistry-Paraffin Filamin B Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FMN2 Antibody
NBP2-24615
Western Blot FMN2 Antibody
Immunohistochemistry-Paraffin FMN2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
DIAPH3 Antibody
(4D5)
H00081624-M01
Immunocytochemistry/ Immunofluorescence DIAPH3 Antibody (4D5)
Western Blot DIAPH3 Antibody (4D5)
Sandwich ELISA DIAPH3 Antibody (4D5)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
FNBP1 Antibody
NBP2-48542
Immunohistochemistry-Paraffin FNBP1 Antibody
Immunohistochemistry-Paraffin FNBP1 Antibody
Western Blot FNBP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
FHDC1 Antibody
NBP1-93579
Immunohistochemistry-Paraffin FHDC1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
WBP4 Antibody
NBP1-84718
Western Blot WBP4 Antibody
Immunohistochemistry-Paraffin WBP4 Antibody
Immunohistochemistry-Paraffin WBP4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cortactin Antibody
NBP2-15971
Western Blot Cortactin Antibody
Western Blot Cortactin Antibody
Immunohistochemistry-Paraffin Cortactin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
FNBP4 Antibody
NBP2-14022
Western Blot FNBP4 Antibody
Immunocytochemistry/ Immunofluorescence FNBP4 Antibody
Immunohistochemistry-Paraffin FNBP4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SRGAP2 Antibody
NBP1-88830
Immunocytochemistry/ Immunofluorescence SRGAP2 Antibody
Immunohistochemistry-Paraffin SRGAP2 Antibody
Immunohistochemistry-Paraffin SRGAP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Gremlin 1 Antibody
[Unconjugated]
AF956
Immunohistochemistry Gremlin 1 Antibody [Unconjugated]
Immunohistochemistry Gremlin 1 Antibody [Unconjugated]
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: Block, IHC

Publications for FMNL3 Protein (NBP1-84092PEP) (0)

There are no publications for FMNL3 Protein (NBP1-84092PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMNL3 Protein (NBP1-84092PEP) (0)

There are no reviews for FMNL3 Protein (NBP1-84092PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FMNL3 Protein (NBP1-84092PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FMNL3 Products

Array NBP1-84092PEP

Blogs on FMNL3

There are no specific blogs for FMNL3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FMNL3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FMNL3