Home » Flightless I » Flightless I Proteins » Flightless I Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Flightless I Recombinant Protein Antigen

 (1 Publication)
 See All Related
Submit a Review

Images

 
There are currently no images for Flightless I Protein (NBP1-87925PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Flightless I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FLII.

Source: E. coli

Amino Acid Sequence: YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FLII
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87925.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-87925PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Flightless I Recombinant Protein Antigen

  • FLI
  • Fli1
  • flightless I homolog (Drosophila)
  • FLILflightless I (Drosophila) homolog
  • MGC39265
  • protein flightless-1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EWSR1 Antibody
NB200-182
Immunohistochemistry-Paraffin EWSR1 Antibody
Immunoprecipitation EWSR1 Antibody
Western Blot EWSR1 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
ERG Antibody - BSA
Free
NBP2-60655
Immunocytochemistry/ Immunofluorescence ERG Antibody - BSA Free
Western Blot ERG Antibody - BSA Free
Immunohistochemistry-Paraffin ERG Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Kv11.1 Antibody -
Azide and BSA Free
NBP3-03109
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Western Blot Kv11.1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CD99 Antibody
[Unconjugated]
AF3968
Flow Cytometry CD99 Antibody [Unconjugated]
Western Blot CD99 Antibody [Unconjugated]
Simple Western CD99 Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western Blot Ets-1 Antibody [Unconjugated]
Immunohistochemistry Ets-1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, WB
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot SCL/Tal1 Antibody (OTI5H1)
Flow Cytometry SCL/Tal1 Antibody (OTI5H1)
Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot PU.1/Spi-1 Antibody
Western Blot PU.1/Spi-1 Antibody
Flow Cytometry PU.1/Spi-1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Gelsolin/GSN
Antibody (893205) [Un ...
MAB8170
Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]
Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]
Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, KO, mIF, Simple Western, WB
SCLY Antibody
NBP2-48693
Immunohistochemistry-Paraffin SCLY Antibody
Immunocytochemistry/ Immunofluorescence SCLY Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(685 Publications)
Species: Hu
Applications: ELISA
ETV1 Antibody (2A8)
H00002115-M01
ELISA ETV1 Antibody (2A8)
Western Blot ETV1 Antibody (2A8)
(2 Publications)
Species: Hu
Applications: ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Flightless I
Recombinant Protein A ...
NBP1-87925PEP
Flightless I Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Flightless I Protein (NBP1-87925PEP)(1)


Reviews for Flightless I Protein (NBP1-87925PEP) (0)

There are no reviews for Flightless I Protein (NBP1-87925PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Flightless I Protein (NBP1-87925PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flightless I Products

Research Areas for Flightless I Protein (NBP1-87925PEP)

Find related products by research area.

Blogs on Flightless I

There are no specific blogs for Flightless I, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Flightless I Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FLII