Novus Biologicals products are now on bio-techne.com

Fibrinogen gamma chain Recombinant Protein Antigen

Images

 
There are currently no images for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Fibrinogen gamma chain Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Fibrinogen gamma chain

Source: E.coli

Amino Acid Sequence: GWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPEHPAETEYDSLYP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FGG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21374. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fibrinogen gamma chain Recombinant Protein Antigen

  • fibrinogen gamma chain
  • fibrinogen, gamma polypeptide

Background

The protein encoded by the Fibrinogen gamma chain gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80414
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DHAPG0
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-45562
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-25459
Species: Hu, Rt
Applications: WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
2914-HT
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NBP2-52932
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-21374PEP
Species: Hu
Applications: AC

Publications for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP) (0)

There are no publications for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP) (0)

There are no reviews for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fibrinogen gamma chain Products

Research Areas for Fibrinogen gamma chain Recombinant Protein Antigen (NBP3-21374PEP)

Find related products by research area.

Blogs on Fibrinogen gamma chain.

CD11b Expression, Leukocyte Adhesion and the Innate Immune System
What is CD11b?CD11b is an integrin family member which pairs with CD18 to form the CR3 heterodimer. CD11b is expressed on the surface of many leukocytes including monocytes, neutrophils, natural killer cells, granulocytes and macrophages, as well as o...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fibrinogen gamma chain Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FGG