![Western Blot: FHIT Antibody [NBP1-89061] - Analysis in control (vector only transfected HEK293T lysate) and FHIT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/FHIT-Antibody-Western-Blot-NBP1-89061-img0006.jpg "Western Blot: FHIT Antibody [NBP1-89061] - Analysis in control (vector only transfected HEK293T lysate) and FHIT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FHIT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 30107138). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP1-89061 | Applications | Species |
|---|---|---|
| Dannewitz Prosseda S, Tian X, Kuramoto K et al. Fragile Histidine Triad (FHIT), a Novel Modifier Gene in Pulmonary Arterial Hypertension Am. J. Respir. Crit. Care Med. 2018-08-14 [PMID: 30107138] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for FHIT Antibody (NBP1-89061)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FHIT |
![Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human testis.](http://images.novusbio.com/fullsize/FHIT-Antibody-Immunohistochemistry-Paraffin-NBP1-89061-img0010.jpg "Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human testis.")
![Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human kidney shows strong cytoplasmic positivity in tubules and weak staining in glomeruli.](http://images.novusbio.com/fullsize/FHIT-Antibody-Immunohistochemistry-Paraffin-NBP1-89061-img0002.jpg "Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human kidney shows strong cytoplasmic positivity in tubules and weak staining in glomeruli.")
![Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human colon, kidney, lymph node and testis using Anti-FHIT antibody NBP1-89061 (A) shows similar protein distribution across tissues to independent antibody NBP1-89062 (B).](http://images.novusbio.com/fullsize/FHIT-Antibody-Immunohistochemistry-Paraffin-NBP1-89061-img0007.jpg "Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human colon, kidney, lymph node and testis using Anti-FHIT antibody NBP1-89061 (A) shows similar protein distribution across tissues to independent antibody NBP1-89062 (B).")
![Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human colon.](http://images.novusbio.com/fullsize/FHIT-Antibody-Immunohistochemistry-Paraffin-NBP1-89061-img0008.jpg "Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human colon.")
![Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human kidney.](http://images.novusbio.com/fullsize/FHIT-Antibody-Immunohistochemistry-Paraffin-NBP1-89061-img0009.jpg "Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human lymph node.](http://images.novusbio.com/fullsize/FHIT-Antibody-Immunohistochemistry-Paraffin-NBP1-89061-img0011.jpg "Immunohistochemistry-Paraffin: FHIT Antibody [NBP1-89061] - Staining of human lymph node.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")