![Western Blot: IRTA1 Antibody [NBP1-69384] - This Anti-FCRL4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize/IRTA1-Antibody-Western-Blot-NBP1-69384-img0001.jpg "Western Blot: IRTA1 Antibody [NBP1-69384] - This Anti-FCRL4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to FCRL4(Fc receptor-like 4) The peptide sequence was selected from the N terminal of FCRL4.
Peptide sequence KIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFR. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FCRL4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot FCRLA/FCRLM1 Antibody (865910) [Unconjugated]](https://images.novusbio.com/images2/FCRLA_MAB7905_Western_Blot_14096.jpg)
![Flow Cytometry FCRLA/FCRLM1 Antibody (865910) [Unconjugated]](https://images.novusbio.com/images2/FCRLA_MAB7905_Flow_Cytometry_14268.jpg)
![Flow Cytometry HVEM/TNFRSF14 Antibody (94801) [Unconjugated]](https://images.novusbio.com/images2/HVEM_MAB356_Flow_Cytometry_19907.jpg)
![Block/ Neutralize HVEM/TNFRSF14 Antibody (94801) [Unconjugated]](https://images.novusbio.com/images/mab356_human-hvem-tnfrsf14-mab-clone-94801-41202412514828.jpg)
![Intracellular Staining by Flow Cytometry FCRLB/FCRY Antibody (454217) [Unconjugated]](https://images.novusbio.com/images2/FCRLB_MAB4705_Flow_Cytometry_8495.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry FCRL2/FcRH2 Antibody (296902) [Unconjugated]](https://images.novusbio.com/images2/FCRL2_MAB2048_Flow_Cytometry_9385.jpg)
![Flow Cytometry FCRL3/FcRH3 Antibody (546828) [Unconjugated]](https://images.novusbio.com/images2/FCRL3_MAB3126_Flow_Cytometry_12516.jpg)
![Neutralization CD27/TNFRSF7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD27_AF382_Block_Neutralize_8868.jpg)
![Immunohistochemistry CD27/TNFRSF7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD27_AF382_Immunohistochemistry_19970.jpg)
![Western Blot CD27/TNFRSF7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD27_AF382_Western_Blot_20114.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Western_Blot_11618.jpg)
![Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Immunohistochemistry_11640.jpg)
![Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Flow_Cytometry_11674.jpg)
![Flow Cytometry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Flow_Cytometry_19328.jpg)
![Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Western_Blot_19363.jpg)
![Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Immunohistochemistry_19379.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")