Home » FATP2/SLC27A2 » SLC27A2 Peptides and Proteins » FATP2/SLC27A2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FATP2/SLC27A2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FATP2/SLC27A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FATP2/SLC27A2.

Source: E. coli

Amino Acid Sequence: SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC27A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05516.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FATP2/SLC27A2 Recombinant Protein Antigen

  • ACSVL1
  • ACSVL1FATP-2
  • EC 6.2.1
  • EC 6.2.1.-
  • EC 6.2.1.3
  • EC 6.2.1.7
  • FACVL1
  • FACVL1very long-chain fatty-acid-coenzyme A ligase 1
  • FATP2
  • FATP2THCA-CoA ligase
  • Fatty acid transport protein 2
  • Fatty-acid-coenzyme A ligase, very long-chain 1
  • hFACVL1
  • HsT17226
  • Long-chain-fatty-acid--CoA ligase
  • SLC27A2
  • solute carrier family 27 (fatty acid transporter), member 2
  • Solute carrier family 27 member 2
  • THCA-CoA ligase
  • very-long-chain acyl-CoA synthetase
  • VLACS
  • VLACSVery long-chain-fatty-acid-CoA ligase
  • VLCS
  • VLCSvery long-chain acyl-CoA synthetase

Background

SLC27A2 is encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCD1 Antibody
(OTI2C12)
NBP2-46476
Western Blot ABCD1 Antibody (OTI2C12)
Immunohistochemistry ABCD1 Antibody (OTI2C12)
Immunohistochemistry ABCD1 Antibody (OTI2C12)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, KO, WB
FATP4/SLC27A4
Antibody
NBP3-05510
Immunocytochemistry/ Immunofluorescence FATP4/SLC27A4 Antibody
Immunohistochemistry-Paraffin FATP4/SLC27A4 Antibody
Western Blot FATP4/SLC27A4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FATP1/SLC27A1
Antibody (308420) [Un ...
MAB3304
Immunocytochemistry FATP1/SLC27A1 Antibody (308420) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
FATP6/SLC27A6
Antibody - BSA Free
NBP2-81909
Western Blot FATP6/SLC27A6 Antibody - BSA Free
Immunohistochemistry FATP6/SLC27A6 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence FATP6/SLC27A6 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
FATP5/SLC27A5
Antibody (9C4D1) - BS ...
NBP2-37412
ELISA FATP5/SLC27A5 Antibody (9C4D1) - BSA Free
Western Blot FATP5/SLC27A5 Antibody (9C4D1) - BSA Free
Western Blot FATP5/SLC27A5 Antibody (9C4D1) - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
ACSL1 Antibody
NBP1-89270
Immunocytochemistry/ Immunofluorescence ACSL1 Antibody
Immunohistochemistry-Paraffin ACSL1 Antibody
Western Blot ACSL1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACSBG1 Antibody
(OTI1D8)
NBP2-02554
Western Blot ACSBG1 Antibody (OTI1D8)
Immunohistochemistry-Paraffin ACSBG1 Antibody (OTI1D8)
Immunohistochemistry-Paraffin ACSBG1 Antibody (OTI1D8)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
FAT1 Antibody
NBP1-84565
Immunohistochemistry-Paraffin FAT1 Antibody
Immunohistochemistry-Paraffin FAT1 Antibody
Immunohistochemistry-Paraffin FAT1 Antibody
(7 Publications)
Species: Hu
Applications: IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
PMP70 Antibody
NBP1-87258
Immunohistochemistry-Paraffin PMP70 Antibody
Immunohistochemistry-Paraffin PMP70 Antibody
Immunohistochemistry-Paraffin PMP70 Antibody
(5 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(130 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FATP3/SLC27A3
Antibody
NBP1-89265
Immunohistochemistry-Paraffin FATP3/SLC27A3 Antibody
Western Blot FATP3/SLC27A3 Antibody
Immunocytochemistry/ Immunofluorescence FATP3/SLC27A3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP) (0)

There are no publications for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP) (0)

There are no reviews for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FATP2/SLC27A2 Recombinant Protein Antigen (NBP3-05516PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FATP2/SLC27A2 Products

Blogs on FATP2/SLC27A2

There are no specific blogs for FATP2/SLC27A2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: CD36 Antibody [NB400-144] - Mouse primary muscle cell lysate. Western blot image submitted by a verified customer review.
CD36 Antibody - BSA Free
NB400-144
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY license.
Fatty Acid Synthase/FASN Antibody
NB400-114
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
NB300-537

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FATP2/SLC27A2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC27A2