![Immunohistochemistry-Paraffin: ESX1 Antibody [NBP2-13973] - Staining in human testis and skeletal muscle tissues using anti-ESX1 antibody. Corresponding ESX1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ESX1-Antibody-Immunohistochemistry-Paraffin-NBP2-13973-img0009.jpg "Immunohistochemistry-Paraffin: ESX1 Antibody [NBP2-13973] - Staining in human testis and skeletal muscle tissues using anti-ESX1 antibody. Corresponding ESX1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: HEPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEGPQPPERKRRRRTAFTQFQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ESX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
![Western Blot SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Western_Blot_5161.jpg)
![Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Chromatin_Immunoprecipitation_11224.jpg)
![Simple Western SOX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX2_AF2018_Simple_Western_16676.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ESX1 |
![Immunocytochemistry/Immunofluorescence: ESX1 Antibody [NBP2-13973] - Staining of human cell line HEK 293 shows localization to nuclear speckles.](http://images.novusbio.com/fullsize/ESX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13973-img0005.jpg "Immunocytochemistry/Immunofluorescence: ESX1 Antibody [NBP2-13973] - Staining of human cell line HEK 293 shows localization to nuclear speckles.")
![Immunohistochemistry-Paraffin: ESX1 Antibody [NBP2-13973] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/ESX1-Antibody-Immunohistochemistry-Paraffin-NBP2-13973-img0007.jpg "Immunohistochemistry-Paraffin: ESX1 Antibody [NBP2-13973] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: ESX1 Antibody [NBP2-13973] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ESX1-Antibody-Immunohistochemistry-Paraffin-NBP2-13973-img0008.jpg "Immunohistochemistry-Paraffin: ESX1 Antibody [NBP2-13973] - Staining of human testis shows high expression.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![LIF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "LIF [Unconjugated]")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")