![Western Blot: ERGIC1 Antibody [NBP1-83962] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-23](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Western-Blot-NBP1-83962-img0021.jpg "Western Blot: ERGIC1 Antibody [NBP1-83962] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-23")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYIL |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERGIC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83962 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERGIC1 |
![Immunocytochemistry/Immunofluorescence: ERGIC1 Antibody [NBP1-83962] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83962-img0007.jpg "Immunocytochemistry/Immunofluorescence: ERGIC1 Antibody [NBP1-83962] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0020.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Western Blot: ERGIC1 Antibody [NBP1-83962] - Analysis in control (vector only transfected HEK293T lysate) and ERGIC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Western-Blot-NBP1-83962-img0011.jpg "Western Blot: ERGIC1 Antibody [NBP1-83962] - Analysis in control (vector only transfected HEK293T lysate) and ERGIC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human prostate shows high expression.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0008.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human prostate shows high expression.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0009.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human skin shows low expression as expected.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining in human prostate and skin tissues using anti-ERGIC1 antibody. Corresponding ERGIC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0010.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining in human prostate and skin tissues using anti-ERGIC1 antibody. Corresponding ERGIC1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human testis.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0013.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human testis.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human liver.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0014.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human liver.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0015.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human lymph node.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0016.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0017.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex, liver, prostate and testis using Anti-ERGIC1 antibody NBP1-83962 (A) shows similar protein distribution across tissues to independent antibody NBP1-83963 (B).](http://images.novusbio.com/fullsize/ERGIC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83962-img0019.jpg "Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex, liver, prostate and testis using Anti-ERGIC1 antibody NBP1-83962 (A) shows similar protein distribution across tissues to independent antibody NBP1-83963 (B).")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")