Home » ERCC8 » ERCC8 Proteins » ERCC8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ERCC8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ERCC8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERCC8.

Source: E. coli

Amino Acid Sequence: LGLELNKDRDVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFDKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58562.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERCC8 Recombinant Protein Antigen

  • CKN1DNA excision repair protein ERCC-8
  • Cockayne syndrome 1 (classical)
  • Cockayne syndrome WD repeat protein CSA
  • CSACockayne syndrome WD-repeat protein CSA
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 8

Background

ERCC8 encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CSB Antibody
NBP1-32405
Immunohistochemistry-Paraffin CSB Antibody
Immunohistochemistry-Paraffin CSB Antibody
Immunoprecipitation CSB Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CSH2 Antibody
NBP2-16019
Western Blot CSH2 Antibody
Immunohistochemistry-Paraffin CSH2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(369 Publications)
Species: Hu
Applications: BA
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Knockout Validated Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(47 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(204 Publications)
Species: Hu
Applications: BA
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(58 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot LAMC2 Antibody (CL2980)
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980)
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/ Immunofluorescence Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Western Blot Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Mas Antibody - BSA
Free
NBP1-78444
Simple Western Mas Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Mas Antibody - BSA Free
Immunohistochemistry Mas Antibody - BSA Free
(2 Reviews)
(21 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(571 Publications)
Species: Hu
Applications: BA
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(58 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB

Publications for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP) (0)

There are no publications for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP) (0)

There are no reviews for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERCC8 Products

Research Areas for ERCC8 Recombinant Protein Antigen (NBP2-58562PEP)

Find related products by research area.

Blogs on ERCC8.

Check out the latest blog posts on ERCC8.
NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERCC8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ERCC8