Home » epithelial Sodium Channel beta » epithelial Sodium Channel beta Proteins » epithelial Sodium Channel beta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

epithelial Sodium Channel beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for epithelial Sodium Channel beta Protein (NBP1-84844PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

epithelial Sodium Channel beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCNN1B.

Source: E. coli

Amino Acid Sequence: GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCNN1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84844.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for epithelial Sodium Channel beta Recombinant Protein Antigen

  • amiloride-sensitive sodium channel subunit beta 1
  • amiloride-sensitive sodium channel subunit beta
  • BESC1
  • Beta-ENaC
  • Beta-NaCH
  • ENaCB
  • ENaCbeta
  • Epithelial Na(+) channel subunit beta
  • epithelial Sodium Channel beta
  • epithelial sodium channel beta-2 subunit
  • epithelial sodium channel beta-3 subunit
  • nasal epithelial sodium channel beta subunit
  • Nonvoltage-gated sodium channel 1 subunit beta
  • SCNEB
  • SCNN1B
  • sodium channel, nonvoltage-gated 1, beta

Background

SCNN1B is a subunit of the epithelial sodium channel, ENaC. ENac has high sodium selectivity, low conductance, and amiloride sensitivity. The functional channel of ENaC is composed of at least 3 subunits, alpha (SCNN1A), beta (SCNN1B), and gamma (SCNN1G). The 3 subunits show sequence similarities to one another, indicating descent from a common ancestral gene. Each encodes a protein containing 2 transmembrane domains, with intracellular amino and carboxyl termini. ENaC in the kidney, lung and colon plays an essential role in trans- epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium re-uptake in the distal nephron of the kidney, thus regulating blood pressure. Mutations in beta or gamma subunit of the epithelial sodium channel (ENaC) have been found to cause a hereditary form of human hypertension, Liddle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

epithelial Sodium
Channel gamma Antibod ...
NBP3-18256
Immunohistochemistry epithelial Sodium Channel gamma Antibody
Western Blot epithelial Sodium Channel gamma Antibody
Western Blot epithelial Sodium Channel gamma Antibody
Species: Ha, Hu, Mu, Rt, Xp
Applications: IHC, WB
epithelial Sodium
Channel alpha Antibod ...
NB100-74357
Western Blot epithelial Sodium Channel alpha Antibody
Immunocytochemistry/ Immunofluorescence epithelial Sodium Channel alpha Antibody
Immunocytochemistry/ Immunofluorescence epithelial Sodium Channel alpha Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
SLC12A3 Antibody
NBP1-44270
Western Blot SLC12A3 Antibody
Immunohistochemistry SLC12A3 Antibody
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NKCC2/SLC12A1
Antibody
NBP1-80993
Immunocytochemistry/ Immunofluorescence NKCC2/SLC12A1 Antibody
Western Blot NKCC2/SLC12A1 Antibody
Immunohistochemistry-Paraffin NKCC2/SLC12A1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Immunohistochemistry-Paraffin Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
Western Blot Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
Immunocytochemistry/ Immunofluorescence Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
(2 Publications)
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
ACCN5 Antibody -
BSA Free
NBP2-92010
Western Blot ACCN5 Antibody - BSA Free
Species: Mu, Rt
Applications: WB
NHE3/SLC9A3
Antibody
NBP1-82574
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
(31 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Recombinant Human
NEDD4L GST (N-Term) P ...
H00023327-P01
Other Recombinant Human NEDD4L GST (N-Term) Protein
(3 Publications)
Species: Hu
Applications: ELISA, AP, PA, WB
SGK1 Antibody
(4D7-G3)
H00006446-M01
Western Blot SGK1 Antibody (4D7-G3)
Immunocytochemistry/ Immunofluorescence SGK1 Antibody (4D7-G3)
Immunohistochemistry-Paraffin SGK1 Antibody (4D7-G3)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
NEDD4 Antibody
(683211) [Unconjugate
MAB6218
Western Blot NEDD4 Antibody (683211) [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
SCNN1D Antibody
NBP1-85004
Immunohistochemistry-Paraffin SCNN1D Antibody
Immunohistochemistry-Paraffin SCNN1D Antibody
Immunocytochemistry/ Immunofluorescence SCNN1D Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(849 Publications)
Species: Hu
Applications: BA
HSD11B2 Antibody
NBP2-37898
Western Blot HSD11B2 Antibody
Immunohistochemistry-Paraffin HSD11B2 Antibody
Immunohistochemistry-Paraffin HSD11B2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for epithelial Sodium Channel beta Protein (NBP1-84844PEP) (0)

There are no publications for epithelial Sodium Channel beta Protein (NBP1-84844PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel beta Protein (NBP1-84844PEP) (0)

There are no reviews for epithelial Sodium Channel beta Protein (NBP1-84844PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for epithelial Sodium Channel beta Protein (NBP1-84844PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional epithelial Sodium Channel beta Products

Research Areas for epithelial Sodium Channel beta Protein (NBP1-84844PEP)

Find related products by research area.

Blogs on epithelial Sodium Channel beta

There are no specific blogs for epithelial Sodium Channel beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our epithelial Sodium Channel beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SCNN1B