Home » ENPP-1 » ENPP-1 Proteins » ENPP-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ENPP-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ENPP-1 Protein (NBP2-38945PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ENPP-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENPP1.

Source: E. coli

Amino Acid Sequence: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ENPP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38945.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ENPP-1 Recombinant Protein Antigen

  • ectonucleotide pyrophosphatase/phosphodiesterase 1
  • E-NPP 1
  • ENPP1
  • ENPP-1
  • Ly-41 Antigen
  • M6S1
  • M6S1NPP1
  • Membrane component chromosome 6 surface marker 1
  • membrane component, chromosome 6, surface marker 1
  • NPP1
  • NPPS
  • NPPSalkaline phosphodiesterase 1
  • PC1
  • PC-1
  • PCA1
  • PCA1ARHR2
  • PDNP1
  • PDNP1ectonucleotide pyrophosphatase/phosphodiesterase family member 1
  • Phosphodiesterase I/nucleotide pyrophosphatase 1
  • plasma-cell membrane glycoprotein 1
  • Plasma-cell membrane glycoprotein PC-1

Background

ENPP1 has a broad specificity and cleaves a variety of substrates, including phosphodiester bonds of nucleotides and nucleotide sugars and pyrophosphate bonds of nucleotides and nucleotide sugars. It can hydrolyze nucleoside 5' triphosphates such as ATP, GTP, CTP, TTP and UTP to their corresponding monophosphates with release of pyrophosphate. It can also hydrolyze diadenosine polyphosphates and 3',5'-cAMP to AMP. It may play a role in the regulation of pyrophosphate production, the regulation of the availability of nucleotide sugars in the endoplasmic reticulum and Golgi, and the regulation of purinergic signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Polycystin 2
Antibody
NBP3-06363
Western Blot Polycystin 2 Antibody
Immunoprecipitation Polycystin 2 Antibody
Immunocytochemistry/ Immunofluorescence Polycystin 2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Proprotein
Convertase 2/PCSK2 An
AF6018
Western Blot Proprotein Convertase 2/PCSK2 Antibody
Immunocytochemistry Proprotein Convertase 2/PCSK2 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC, IP, WB
Cytokeratin 17
Antibody
NBP2-38536
Immunocytochemistry/ Immunofluorescence Cytokeratin 17 Antibody
Immunocytochemistry/ Immunofluorescence Cytokeratin 17 Antibody
Immunocytochemistry/ Immunofluorescence Cytokeratin 17 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cytokeratin 6b
Antibody
NBP2-14924
Immunocytochemistry/ Immunofluorescence Cytokeratin 6b Antibody
Immunohistochemistry-Paraffin Cytokeratin 6b Antibody
Western Blot Cytokeratin 6b Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CBX4 Antibody
(6C5G3) - BSA Free
NBP2-52432
ELISA CBX4 Antibody (6C5G3) - BSA Free
Flow Cytometry CBX4 Antibody (6C5G3) - BSA Free
Immunohistochemistry-Paraffin CBX4 Antibody (6C5G3) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Proprotein
Convertase 1/PCSK1 An ...
H00005122-M02
Immunocytochemistry/ Immunofluorescence Proprotein Convertase 1/PCSK1 Antibody (3D2)
Immunohistochemistry-Paraffin Proprotein Convertase 1/PCSK1 Antibody (3D2)
Sandwich ELISA Proprotein Convertase 1/PCSK1 Antibody (3D2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Furin Antibody
NB100-1903
Flow Cytometry Furin Antibody
Western Blot Furin Antibody
Immunocytochemistry/ Immunofluorescence Furin Antibody
(1 Review)
(2 Publications)
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Polycystin-1/PKD1
Antibody [Unconjugate ...
AF6270
Immunocytochemistry Polycystin-1/PKD1 Antibody [Unconjugated]
Species: Hu
Applications: ICC
Cbx8 Antibody
NBP1-83224
Immunocytochemistry/ Immunofluorescence Cbx8 Antibody
Immunohistochemistry-Paraffin Cbx8 Antibody
Immunohistochemistry-Paraffin Cbx8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACTR1B Antibody
NBP2-15275
Western Blot ACTR1B Antibody
Western Blot ACTR1B Antibody
Immunohistochemistry-Paraffin ACTR1B Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BTG2 Antibody
(OTI4C10)
NBP2-46587
Immunohistochemistry BTG2 Antibody (OTI4C10)
Immunohistochemistry BTG2 Antibody (OTI4C10)
Immunohistochemistry BTG2 Antibody (OTI4C10)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PC6 Antibody
NBP1-87326
Immunocytochemistry/ Immunofluorescence PC6 Antibody
Immunohistochemistry-Paraffin PC6 Antibody
Immunohistochemistry-Paraffin PC6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FLVCR Antibody
NB100-1481
Western Blot FLVCR Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: PEP-ELISA, WB
PACE4/PCSK6
Antibody
NBP1-87354
Immunohistochemistry-Paraffin PACE4/PCSK6 Antibody
Immunohistochemistry-Paraffin PACE4/PCSK6 Antibody
Immunohistochemistry-Paraffin PACE4/PCSK6 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Proprotein
Convertase 7/PCSK7 An ...
NBP2-73621
Flow Cytometry Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
Carboxypeptidase
E/CPE Antibody [Uncon ...
AF3587
Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB

Publications for ENPP-1 Protein (NBP2-38945PEP) (0)

There are no publications for ENPP-1 Protein (NBP2-38945PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENPP-1 Protein (NBP2-38945PEP) (0)

There are no reviews for ENPP-1 Protein (NBP2-38945PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ENPP-1 Protein (NBP2-38945PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ENPP-1 Products

Research Areas for ENPP-1 Protein (NBP2-38945PEP)

Find related products by research area.

Blogs on ENPP-1

There are no specific blogs for ENPP-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ENPP-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ENPP1