![Western Blot: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - SH3GL2 monoclonal antibody (M01), clone 5A6 Analysis of SH3GL2 expression in PC-12.](http://images.novusbio.com/fullsize/Endophilin-A1-SH3GL2-Antibody-5A6-Western-Blot-H00006456-M01-img0007.jpg "Western Blot: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - SH3GL2 monoclonal antibody (M01), clone 5A6 Analysis of SH3GL2 expression in PC-12.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC, IP |
| Clone | 5A6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL |
| Specificity | SH3GL2 - SH3-domain GRB2-like 2 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SH3GL2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Endophilin A1/SH3GL2 Antibody (H00006456-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Analysis of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Endophilin-A1-SH3GL2-Antibody-5A6-Immunohistochemistry-Paraffin-H00006456-M01-img0005.jpg "Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Analysis of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 3 ug/ml.")
![Sandwich ELISA: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Detection limit for recombinant GST tagged SH3GL2 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Endophilin-A1-SH3GL2-Antibody-5A6-Sandwich-ELISA-H00006456-M01-img0006.jpg "Sandwich ELISA: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Detection limit for recombinant GST tagged SH3GL2 is approximately 0.1ng/ml as a capture antibody.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
