![Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of mouse embryo E11 shows moderate nuclear positivity in neuronal cells in developing cortex.](http://images.novusbio.com/fullsize/Emx1-Antibody-Immunohistochemistry-Paraffin-NBP1-86500-img0009.jpg "Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of mouse embryo E11 shows moderate nuclear positivity in neuronal cells in developing cortex.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EMX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86500 | Applications | Species |
|---|---|---|
| Lancaster MA, Renner M, Martin CA et al. Cerebral organoids model human brain development and microcephaly. Nature 2013-09-19 [PMID: 23995685] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EMX1 |
![Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human kidney shows moderate nuclear positivity in cells in a subset of renal tubules.](http://images.novusbio.com/fullsize/Emx1-Antibody-Immunohistochemistry-Paraffin-NBP1-86500-img0006.jpg "Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human kidney shows moderate nuclear positivity in cells in a subset of renal tubules.")
![Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/Emx1-Antibody-Immunohistochemistry-Paraffin-NBP1-86500-img0008.jpg "Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![Western Blot EMX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMX2_AF6470_Western_Blot_10298.jpg)
![Immunocytochemistry EMX2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af6470_human-mouse-emx2-affinity-purified-polyclonal-ab-immunocytochemistry-241202491313..jpg)
![Immunocytochemistry Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Immunocytochemistry_11033.jpg)
![Immunohistochemistry Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Immunohistochemistry_22974.jpg)
![Simple Western Otx2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Otx2_AF1979_Simple_Western_20223.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-285202411422.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-immunohistochemistry-285202411531..jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")