![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0010.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human cerebral cortex.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TEEIMSGGGSRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EIF4G3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF4G3 |
![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0004.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0005.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0006.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0007.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-EIF4G3 antibody NBP1-84865 (A) shows similar protein distribution across tissues to independent antibody NBP1-84867 (B).](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0008.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-EIF4G3 antibody NBP1-84865 (A) shows similar protein distribution across tissues to independent antibody NBP1-84867 (B).")
![Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human lymph node.](http://images.novusbio.com/fullsize/eIF4GII-Antibody-Immunohistochemistry-Paraffin-NBP1-84865-img0009.jpg "Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84865] - Staining of human lymph node.")
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")