Home » EIF3M » EIF3M Proteins » Recombinant Human EIF3M GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human EIF3M GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human EIF3M GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-374 of Human EIF3M

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
EIF3M
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
68.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF3M GST (N-Term) Protein

  • B5 receptor
  • dendritic cell protein
  • eIF3m
  • eukaryotic translation initiation factor 3 subunit M
  • eukaryotic translation initiation factor 3, subunit M
  • Fetal lung protein B5
  • FLJ29030
  • GA17
  • HFLB5
  • hfl-B5
  • PCI domain containing 1 (herpesvirus entry mediator)
  • PCI domain-containing protein 1
  • PCID1B5

Background

HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/ Immunofluorescence SPANXB1 Antibody
Western Blot SPANXB1 Antibody
Species: Hu
Applications: ICC/IF, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
GPHA2 Antibody
NBP3-17255
Western Blot GPHA2 Antibody
Immunocytochemistry/ Immunofluorescence GPHA2 Antibody
Species: Hu
Applications: ICC/IF, WB
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
Immunohistochemistry-Frozen alpha-Sarcoglycan Antibody (JA51-81)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
ATP6V0A2 Antibody
NBP1-59069
Western Blot ATP6V0A2 Antibody
Western Blot ATP6V0A2 Antibody
Immunohistochemistry-Paraffin ATP6V0A2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western Blot RFC1 Antibody [Unconjugated]
Species: Hu
Applications: WB
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/ Immunofluorescence ATP6V0A1 Antibody
Immunohistochemistry-Paraffin ATP6V0A1 Antibody
Immunohistochemistry-Paraffin ATP6V0A1 Antibody
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot RFC2 Antibody (OTI2B2) - Azide and BSA Free
Flow Cytometry RFC2 Antibody (OTI2B2) - Azide and BSA Free
Immunohistochemistry RFC2 Antibody (OTI2B2) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
RFC4 Antibody
(OTI1A8)
NBP2-45946
Immunocytochemistry/ Immunofluorescence RFC4 Antibody (OTI1A8)
Immunohistochemistry RFC4 Antibody (OTI1A8)
Immunohistochemistry RFC4 Antibody (OTI1A8)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA HLA B Antibody (2G7B10) - BSA Free
Flow Cytometry HLA B Antibody (2G7B10) - BSA Free
Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NDUFA2 Antibody -
BSA Free
NBP2-93743
Immunocytochemistry/ Immunofluorescence NDUFA2 Antibody - BSA Free
Western Blot NDUFA2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]
Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]
Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]
(25 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
TCIRG1 Antibody
(6H3)
H00010312-M01
Western Blot TCIRG1 Antibody (6H3)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, WB

Publications for EIF3M Recombinant Protein (H00010480-P01) (0)

There are no publications for EIF3M Recombinant Protein (H00010480-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3M Recombinant Protein (H00010480-P01) (0)

There are no reviews for EIF3M Recombinant Protein (H00010480-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF3M Recombinant Protein (H00010480-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF3M Products

Blogs on EIF3M

There are no specific blogs for EIF3M, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF3M GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol EIF3M