![Western Blot: EDC4 Antibody [NBP2-13944] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize/EDC4-Antibody-Western-Blot-NBP2-13944-img0007.jpg "Western Blot: EDC4 Antibody [NBP2-13944] - Analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: VERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDA |
| Predicted Species | Mouse (98%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EDC4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for EDC4 Antibody (NBP2-13944)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EDC4 |
![Immunocytochemistry/Immunofluorescence: EDC4 Antibody [NBP2-13944] - Staining of human cell line A-431 shows localization to nucleoplasm & cytoplasmic bodies.](http://images.novusbio.com/fullsize/EDC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13944-img0005.jpg "Immunocytochemistry/Immunofluorescence: EDC4 Antibody [NBP2-13944] - Staining of human cell line A-431 shows localization to nucleoplasm & cytoplasmic bodies.")
![Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/EDC4-Antibody-Immunohistochemistry-Paraffin-NBP2-13944-img0011.jpg "Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/EDC4-Antibody-Immunohistochemistry-Paraffin-NBP2-13944-img0008.jpg "Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/EDC4-Antibody-Immunohistochemistry-Paraffin-NBP2-13944-img0009.jpg "Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Lymph node shows strong cytoplasmic positivity in germinal center and non-germinal center cells.](http://images.novusbio.com/fullsize/EDC4-Antibody-Immunohistochemistry-Paraffin-NBP2-13944-img0010.jpg "Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Lymph node shows strong cytoplasmic positivity in germinal center and non-germinal center cells.")
![Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Testis shows moderate cytoplasmic positivity in spermatogonia and Leydig cells.](http://images.novusbio.com/fullsize/EDC4-Antibody-Immunohistochemistry-Paraffin-NBP2-13944-img0012.jpg "Immunohistochemistry-Paraffin: EDC4 Antibody [NBP2-13944] - Staining of human Testis shows moderate cytoplasmic positivity in spermatogonia and Leydig cells.")
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")