Name: Dcp1a Antibody (3G4)
Brand: Novus Biologicals
SKU: H00055802-M06
Rating: 5 (1 reviews)

- COVID-19 Research Tools
  
  Antibodies
  Primary Antibodies
  Conjugated Antibodies
  
  Sample Size Antibodies
  
  KO Validated Antibodies
  
  Recombinant Antibodies
  
  Antibody Sampler Packs
  
  Antibody Pairs
  
  Secondary Antibodies
  
  Isotype Control Antibodies
  
  Proteins and Peptides
  Peptides & Proteins
  
  Blocking Peptides
  
  Biologically Active Proteins
  
  Lysates and Cell Lines
  Lysates
  
  Stem Cell Lines
- Kits
  Antibody Labeling Kits
  
  ChIP Kits
  
  ELISA Kits
  
  Flow Cytometry Kits
  
  Activators and Inhibitors
  Inhibitors
  
  Activators
  
  Support Products
  Exosome Isolation
  
  Flow Cytometry Beads
  
  IHC Tissue Slides
  
  IHC Microarrays
  
  Western Blot Gels & Buffers
  
  Western Blot Membranes
  
  All Support Products
  
  Bulk and Custom
Products
Our Protocols
- Resources
  Protocols
  
  Video Protocols
  
  Troubleshooting Guides
  
  Posters and Literature
  
  Handbooks and Guides
  
  Calculators
  
  FAQs
  
  Blogs
  
  Diseases
  
  Whitepapers
  
  Antibody Concierge
  
  Webinars
- Tools
  Spectra Viewer
  
  Flow Cytometry Panel Builder
  
  Application
  ELISA
  
  Flow Cytometry
  
  Mass Cytometry (CyTOF)
  
  ICC
  
  IHC
  
  Western Blotting
  
  Interviews
  Faculty
  
  Postdoc
Resources
View Pathways
- By Research Area
  Apoptosis
  
  Autophagy
  
  Cancer
  
  Cell Biology
  
  Cellular Markers
  
  Epigenetics
  
  Epitope Tags
  
  Exosomes Research
  
  Hypoxia
  
  Immunology
  
  Microbiology
  
  Neuroscience
  
  Stem Cells
- By Pathway
  AKT
  
  Apoptosis
  
  Autophagy
  
  ERK1/2/5 Pathway
  
  Hedgehog
  
  Hippo
  
  JNK Pathway
  
  mTOR
  
  Necroptosis
  
  NFKB Signaling
  
  p38 Signaling
  
  TGF Beta
  
  TLR
Research Areas
Get Rewards
- Customer Care
  100% Guarantee
  
  Risk Free Testing
  
  Novus Rewards Program
  
  Publication Rewards Program
  
  New Lab Discount
  
  Scholarship
  
  Travel Grants
  
  Promotions
Customer Care
Novus Careers
- About us
  Careers
  
  Collaborations
  
  Events
  
  Novus Story
  
  Our Team
  
  Philanthropy
  
  Press Releases
  
  Why choose Novus
About Us
- Contact Us
  Customer Service
  
  Distributors
  
  Technical Support
Contact

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, Rt, ISpecies Glossary
Applications	WB, ELISA, Func, ICC/IF, IHC, IP
Clone	3G4
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Immunogen	DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Specificity	DCP1A - DCP1 decapping enzyme homolog A (S. cerevisiae)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	DCP1A
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Publications using H00055802-M06	Applications	Species
De Luca C, Gupta A, Bortvin A Retrotransposon LINE-1 bodies in the cytoplasm of piRNA-deficient mouse spermatocytes: Ribonucleoproteins overcoming the integrated stress response PLoS genetics 2023-06-01 [PMID: 37307272]
Eri A, Akira Y, Mai S et al. The association of UBAP2L and G3BP1 mediated by small nucleolar RNA is essential for stress granule formation. Commun Biol. 2023-04-14 [PMID: 37059803]
Nicolas C; Olivia L; Juan-Pablo C et al. The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation. Cell Rep. 2023-03-07 [PMID: 36884350]
Barbara S, Rene G, Julia J et al. FUS ALS neurons activate major stress pathways and reduce translation as an early protective mechanism against neurodegeneration. Cell Rep. 2023-01-24 [PMID: 36696267]
Cheng S, Altmeppen G, So C et al. Mammalian oocytes store mRNAs in a mitochondria-associated membraneless compartment Science (New York, N.Y.) 2022-10-21 [PMID: 36264786] (ICC/IF, Mouse)	ICC/IF	Mouse
Kim J, Muraoka M, Okada H et al. The RNA helicase DDX6 controls early mouse embryogenesis by repressing aberrant inhibition of BMP signaling through miRNA-mediated gene silencing PLOS Genetics 2022-10-05 [PMID: 36197846] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence)	Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
Kleer M, Mulloy RP, Robinson CA et al. Human coronaviruses disassemble processing bodies PLOS Pathogens 2022-08-23 [PMID: 35998203] (Western Blot, Immunocytochemistry/ Immunofluorescence)	Western Blot, Immunocytochemistry/ Immunofluorescence
S Kedia, MR Aghanoori, KML Burns, M Subha, L Williams, P Wen, D Kopp, SL Erickson, EM Harvey, X Chen, M Hua, JU Perez, F Ishraque, G Yang Ubiquitination and deubiquitination of 4E-T regulate neural progenitor cell maintenance and neurogenesis by controlling P-body formation Oncogene, 2022-07-12;40(2):111070. 2022-07-12 [PMID: 35830814]
MJ MacPherson, SL Erickson, D Kopp, P Wen, MR Aghanoori, S Kedia, KML Burns, A Vitobello, F Tran Mau-T, Q Thomas, NB Gold, W Brucker, L Amlie-Wolf, KW Gripp, O Bodamer, L Faivre, M Muona, L Menzies, J Baptista, K Guegan, A Male, XC Wei, G He, Q Long, AM Innes, G Yang Nucleocytoplasmic transport of the RNA-binding protein CELF2 regulates neural stem cell fates Cell Reports, 2021-06-08;35(10):109226. 2021-06-08 [PMID: 34107259]
Tom V, Anna-Lena N, Rui Y et al. Inherited deficiency of stress granule ZNFX1 in patients with monocytosis and mycobacterial disease. Proc Natl Acad Sci U S A. 2021-04-13 [PMID: 33876776]
Mayr-Buro C, Schlereth E, Beuerlein K et al. Single-Cell Analysis of Multiple Steps of Dynamic NF-?B Regulation in Interleukin-1?-Triggered Tumor Cells Using Proximity Ligation Assays. Cancers (Basel). 2019-08-16 [PMID: 31426445]
Das R, Schwintzer L, Vinopal S New roles for the de-ubiquitylating enzyme OTUD4 in an RNA-protein network and RNA granules J. Cell. Sci. 2019-05-28 [PMID: 31138677] (ICC/IF, Human)	ICC/IF	Human
Xu W, Bao P, Jiang X et al. Reactivation of nonsense-mediated mRNA decay protects against C9orf72 dipeptide-repeat neurotoxicity. Brain. 2019-05-01 [PMID: 30938419]
Shimada R, Kiso M, Saga Y et al. ES-mediated chimera analysis revealed requirement of DDX6 for NANOS2 localization and function in mouse germ cells. Sci Rep. 2019-01-24 [PMID: 30679547]
Li J, Hu S, Xu F et al. MOV10 sequesters the RNP of influenza A virus in the cytoplasm and is antagonized by viral NS1 protein. Biochem. J. 2019-01-07 [PMID: 30617221] (WB, Human)	WB	Human
Ozeki K, Sugiyama M, Akter KA et al. FAM98A is localized to stress granules and associates with multiple stress granule-localized proteins. Mol Cell Biochem 2018-07-10 [PMID: 29992460]
Tervaniemi MH, Katayama S, Skoog T et al. Intracellular signalling pathways and cytoskeletal functions converge on the psoriasis candidate gene CCHCR1 expressed at P-bodies and centrosomes. BMC Genomics 2018-06-04 [PMID: 29866042]
Kato Y, Katsuki T, Kokubo H et al. Dazl is a target RNA suppressed by mammalian NANOS2 in sexually differentiating male germ cells. Nat Commun 2016-04-13 [PMID: 27072294] (WB)	WB
Amadei G, Zander MA, Yang G et al. A Smaug2-Based Translational Repression Complex Determines the Balance between Precursor Maintenance versus Differentiation during Mammalian Neurogenesis. J Neurosci. 2015-11-25 [PMID: 26609159]
Seto E, Onizuka Y, Nakajima-Shimada J. Host cytoplasmic processing bodies assembled by Trypanosoma cruzi during infection exert anti-parasitic activity. Parasitol Int. 2015-07-30 [PMID: 26232634]
Ghosh S, Bose M, Ray A et al. Polysome arrest restricts miRNA turnover by preventing exosomal export of miRNA in growth-retarded mammalian cells. Mol Biol Cell. 2015-03-15 [PMID: 25609084] (WB, Human)	WB	Human
Terrell AM, Anand D, Smith SF et al. Molecular characterization of mouse lens epithelial cell lines and their suitability to study RNA granules and cataract associated genes. Exp. Eye Res. 2014-12-19 [PMID: 25530357] (ICC/IF, Mouse)	ICC/IF	Mouse
Perez-Vilaro G, Fernandez-Carrillo C, Mensa L et al. Hepatitis C virus infection inhibits P-body granule formation in human livers. J Hepatol. 2014-11-06 [PMID: 25463546]
Seto E, Inoue T, Nakatani Y et al. Processing bodies accumulate in human cytomegalovirus-infected cells and do not affect viral replication at high multiplicity of infection. Virology. 2014-06-01 [PMID: 24928047]
Ling Y H, Wong C C, Li K W et al. CCHCR1 interacts with EDC4, suggesting its localization in P-bodies. Exp Cell Res. 2014-09-10 [PMID: 24858563] (Human)		Human
Kaehler C, Isensee J, Hucho T et al. 5-Fluorouracil affects assembly of stress granules based on RNA incorporation. Nucleic Acids Res. 2014-04-11 [PMID: 24728989]
Li Y, Masaki T, Shimakami T, Lemon SM. hnRNP L and NF90 interact with hepatitis C virus 5' terminal untranslated RNA and promote efficient replication. J Virol. 2014-04-09 [PMID: 24719423]
Haeusler AR, Donnelly CJ, Periz G et al. C9orf72 nucleotide repeat structures initiate molecular cascades of disease. Nature 2014-03-05 [PMID: 24598541] (Human)		Human
Martinez JP, Perez-Vilaro G, Muthukumar Y et al. Screening of small molecules affecting mammalian P-body assembly uncovers links with diverse intracellular processes and organelle physiology. RNA Biol. 2013-11-01 [PMID: 24418890] (Human)		Human
Dougherty JD, Reineke LC, Lloyd RE. mRNA Decapping Enzyme 1a (Dcp1a) Induced Translational Arrest Through PKR Activation Requires the N-terminal EVH1 Domain. J Biol Chem 2013-12-31 [PMID: 24382890] (WB, Human)	WB	Human
Jakobson M, Jakobson M, Llano O et al. Multiple mechanisms repress N-Bak mRNA translation in the healthy and apoptotic neurons. Cell Death Dis. 2013-08-22 [PMID: 23969856]
Lee H, Komano J, Saitoh Y et al. Zinc-finger antiviral protein mediates retinoic acid inducible gene I-like receptor-independent antiviral response to murine leukemia virus. Proc Natl Acad Sci U S A. 2013-07-23 [PMID: 23836649] (WB)	WB
Cohen-Katsenelson K, Wasserman T, Darlyuk-Saadon I et al. Identification and analysis of a novel dimerization domain shared by various members of c-Jun N-terminal kinase (JNK) scaffold proteins. J Biol Chem. 2013-03-08 [PMID: 23341463] (Human)		Human
Wang CY, Chen WL, Wang SW. Pdc1 functions in the assembly of P bodies in Schizosaccharomyces pombe. Mol Cell Biol. 2013-03-01 [PMID: 23319050] (ICC/IF)	ICC/IF
Aizer A, Kafri P, Kalo A, Shav-Tal Y. The P Body Protein Dcp1a Is Hyper-phosphorylated during Mitosis. PLoS One. 2013-01-02 [PMID: 23300942]
de Vries S, Naarmann-de Vries IS, Urlaub H et al. Identification of DEAD-box RNA Helicase 6 (DDX6) as a Cellular Modulator of Vascular Endothelial Growth Factor Expression under Hypoxia. J Biol Chem. 2013-01-04 [PMID: 23293030]
Perez-Pepe M, Slomiansky V, Loschi M et al. BUHO: A MATLAB Script for the Study of Stress Granules and Processing Bodies by High-Throughput Image Analysis. PLoS One. 2012-12-20 [PMID: 23284702]
Li Y, Masaki T, Yamane D et al. Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication. Proc Natl Acad Sci U S A. 2012-12-17 [PMID: 23248316]
Mok BW, Song W, Wang P et al. The NS1 Protein of Influenza A Virus Interacts with Cellular Processing Bodies and Stress Granules through RNA-Associated Protein 55 (RAP55) during Virus Infection. J Virol. 2012-09-12 [PMID: 22973032]
Li Y, Chen R, Zhou Q et al. LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection. Proc Natl Acad Sci U S A. 2012-06-28 [PMID: 22745163]
Thomas MG, Luchelli L, Pascual M et al. A Monoclonal Antibody against p53 Cross-Reacts with Processing Bodies. PLoS One. 2012-05-10 [PMID: 22590546]
Kobayashi T, Winslow S, Sunesson L et al. PKCalpha Binds G3BP2 and Regulates Stress Granule Formation Following Cellular Stress. PLoS One. 2012-04-20 [PMID: 22536444]
Osugi K, Suzuki H, Nomura T et al. Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and Far-Western screening of proline-rich proteins. J Biochem. 2012-03-20 [PMID: 22437941]
Baez MV, Luchelli L, Maschi D et al. Smaug1 mRNA-silencing foci respond to NMDA and modulate synapse formation. J Cell Biol. 2011-12-26 [PMID: 22201125]
Yu SF, Lujan P, Jackson DL et al. The DEAD-box RNA Helicase DDX6 is Required for Efficient Encapsidation of a Retroviral Genome. PLoS Pathog. 2011-10-13 [PMID: 22022269]
Shih JW, Wang WT, Tsai TY et al. Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response. Biochem J. 2012-01-01 [PMID: 21883093] (IP, Human)	IP	Human
Rzeczkowski K, Beuerlein K, Muller H et al. c-Jun N-terminal kinase phosphorylates DCP1a to control formation of P bodies. J Cell Biol. 2011-08-22 [PMID: 21859862]
Li Y, Song M, Kiledjian M. Differential utilization of decapping enzymes in mammalian mRNA decay pathways. RNA. 2011-01-11 [PMID: 21224379]
Dougherty JD, White JP, Lloyd RE. Poliovirus-mediated disruption of cytoplasmic processing bodies. J Virol. 2011-01-01 [PMID: 20962086]
Suzuki A, Igarashi K, Aisaki K et al. NANOS2 interacts with the CCR4-NOT deadenylation complex and leads to suppression of specific RNAs. Proc Natl Acad Sci U S A 107(8):3594-9. 2010-02-23 [PMID: 20133598]
Aravin AA, van der Heijden GW, Castaneda J et al. Cytoplasmic compartmentalization of the fetal piRNA pathway in mice. PLoS Genet. 2009-12-01 [PMID: 20011505]
Wasserman T, Katsenelson K, Daniliuc S et al. A novel c-Jun N-terminal kinase (JNK)-binding protein WDR62 is recruited to stress granules and mediates a nonclassical JNK activation. Mol Biol Cell 21(1):117-30. 2010-01-01 [PMID: 19910486]
Beaudoin S, Verperre B, Grenier C et al. A large ribonucleoprotein particle induced by cytoplasmic PrP shares striking similarities with the chromatoid body, an RNA granule predicted to function in posttranscriptional gene regulation. Biochim Biophys Acta. 2008-10-30 [PMID: 19014979]
Aizer A, Brody Y, Ler LW et al. The Dynamics of Mammalian P Body Transport, Assembly Disassembly In Vivo. Mol Biol Cell;19(10):4154-66. 2008-10-01 [PMID: 18653466]
Show All 54 Publications. Collapse Publications.

Dcp1a Antibody (3G4)

Species Glossary

Images

Product Details

Order Details

Dcp1a Antibody (3G4) Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for Dcp1a Antibody (3G4)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Dcp1a Antibody (H00055802-M06)(54)

Review for Dcp1a Antibody (H00055802-M06) (1) 51

Summary

Comments

Product General Protocols

Video Protocols

FAQs for Dcp1a Antibody (H00055802-M06) (0)

Secondary Antibodies

Isotype Controls

Additional Dcp1a Products

Blogs on Dcp1a

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Recent Reviews

Bioinformatics

	Verified Customer 03/16/2018
Application:	ICC
Species:	Mus Musculus

Gene Symbol	DCP1A
Entrez	55802(Human)
OMIM	607010(Human)
Uniprot	NP_060873(Human)