Home » DUOX1 » DUOX1 Proteins » DUOX1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DUOX1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DUOX1 Protein (NBP1-81301PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DUOX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUOX1.

Source: E. coli

Amino Acid Sequence: QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DUOX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81301.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DUOX1 Recombinant Protein Antigen

  • dual oxidase 1
  • DUOX
  • EC 1.11.1.-
  • EC 1.6.3.1
  • Large NOX 1
  • LNOX1flavoprotein NADPH oxidase
  • Long NOX 1
  • MGC138840
  • NADPH thyroid oxidase 1
  • nicotinamide adenine dinucleotide phosphate oxidase
  • NOXEF1
  • THOX1MGC138841
  • Thyroid oxidase 1

Background

The DUOX1 gene encodes a glycoprotein dual oxidase 1 protein with an isoform 1 of 1,551 amino acids long at 177 kDA and an isoform 2 at 1,197 amino acids long at 137 kDA. This protein is called a dual oxidase because it obtains a peroxidase homology domain and a gp91phox domain. DUOX1 generates hydrogen peroxide which is essential for thyroid peroxidase/TPO and lactoperoxidase/LPO, as well as lactoperoxidase-mediated antimicrobial defense. DUOX1 interacts with genes TXNDC11 and TPO and has been investigated for its role in various diseases such as thyroiditis, lung cancer, alcoholism, carcinoma, chronic obstructive pulmonary disease, hypothyroidism, hepatitis, prostatitis, and chronic granulomatous disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DUOX2 Antibody -
BSA Free
NB110-61576
Immunocytochemistry/ Immunofluorescence DUOX2 Antibody - BSA Free
Western Blot DUOX2 Antibody - BSA Free
Western Blot DUOX2 Antibody - BSA Free
(12 Publications)
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CYBB/NOX2 Antibody
- BSA Free
NBP2-41291
Immunohistochemistry-Paraffin CYBB/NOX2 Antibody - BSA Free
Immunohistochemistry-Paraffin CYBB/NOX2 Antibody - BSA Free
Immunohistochemistry CYBB/NOX2 Antibody - BSA Free
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Thyroid Peroxidase
Antibody
NBP1-80670
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
NCF1 Antibody
NB100-790
Western Blot NCF1 Antibody
Immunofluorescence NCF1 Antibody
Flow Cytometry NCF1 Antibody
(5 Publications)
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NOX1 Antibody
NBP1-31546
Flow Cytometry NOX1 Antibody
Immunocytochemistry/ Immunofluorescence NOX1 Antibody
Western Blot NOX1 Antibody
(1 Review)
(34 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Nox4 Antibody -
BSA Free
NB110-58849
Knockdown Validated Nox4 Antibody - BSA Free
Immunohistochemistry Nox4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Nox4 Antibody - BSA Free
(8 Reviews)
(113 Publications)
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Recombinant Human
NIP GST (N-Term) Prot ...
H00090527-P01
Other Recombinant Human NIP GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Cytochrome b245
alpha Antibody (CS9)
NBP1-40974
Flow Cytometry Cytochrome b245 alpha Antibody (CS9)
Flow Cytometry Cytochrome b245 alpha Antibody (CS9)
(1 Publication)
Species: Hu
Applications: ELISA, Flow, IHC, IHC-Fr, IP, WB
DUOXA2 Antibody
NBP2-57547
Immunohistochemistry-Paraffin DUOXA2 Antibody
Immunohistochemistry-Paraffin DUOXA2 Antibody
Immunohistochemistry-Paraffin DUOXA2 Antibody
Species: Hu
Applications: IHC, IHC-P
SCGF/CLEC11a
Antibody (239029) [Un ...
MAB1904
Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, IHC, WB
AKAP13 Antibody
NBP1-89163
Immunocytochemistry/ Immunofluorescence AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NSFL1C Antibody
NBP2-13677
Immunocytochemistry/ Immunofluorescence NSFL1C Antibody
Immunohistochemistry-Paraffin NSFL1C Antibody
Immunohistochemistry-Paraffin NSFL1C Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ING1 Antibody
AF5758
Western Blot ING1 Antibody
Immunocytochemistry ING1 Antibody
Immunohistochemistry ING1 Antibody
Species: Hu
Applications: ICC, IHC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for DUOX1 Protein (NBP1-81301PEP) (0)

There are no publications for DUOX1 Protein (NBP1-81301PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUOX1 Protein (NBP1-81301PEP) (0)

There are no reviews for DUOX1 Protein (NBP1-81301PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DUOX1 Protein (NBP1-81301PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DUOX1 Products

Array NBP1-81301PEP

Blogs on DUOX1

There are no specific blogs for DUOX1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry-Paraffin: DUOX1 Antibody [NB100-93521] - Staining of Human Thyroid Gland. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
DUOX1 Antibody
NB100-93521
Knockdown Validated: Nox4 Antibody - BSA Free [NB110-58849] - DSC inhibits Nox4-mediated redox imbalance in BMDM. BMDM was treated with or without DSC (50 umol/L) or Nox4 siRNA. Representative bands and quantitative analysis of Nox4. Data shown are means +/- SEM of n = 8 in each group. *P < 0.05 vs Control cell (CTL), #P < 0.05 vs LPS-stimulated BMDM. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32945118/) licensed under a CC-BY license.
Nox4 Antibody - BSA Free
NB110-58849

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DUOX1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DUOX1