DNA Polymerase gamma Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
The specific Immunogen is proprietary information. Peptide sequence QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
POLG |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for DNA Polymerase gamma Antibody
Background
As the only DNA polymerase (pol) present in mitochondria, DNA polymerase gamma (POLG) is necessarily implicated in base excision repair processes to correct oxidative damage to the mitochondrial genome. Therefore, the ability of the catalytic subunit of human POLG has been tested to participate in uracil-provoked base excision repair reconstituted in vitro with purified components. Subsequent to actions of uracil-DNA glycosylase and apurinic/apyrimidinic endonuclease, human POLG is able to fill a single nucleotide gap in the presence of a 5' terminal deoxyribose phosphate (dRP) flap. The catalytic subunit of human pol gamma catalyzes release of the dRP residue from incised apurinic/apyrimidinic sites to produce a substrate for DNA ligase. Faulty replication of the human mitochondrial genome is thought to be the cause of many diseases. The low selectivity of the mitochondrial DNA polymerase is implicated as the cause of many side effects observed in the treatment of viral infections such as HIV.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Publications for DNA Polymerase gamma Antibody (NBP1-79290) (0)
There are no publications for DNA Polymerase gamma Antibody (NBP1-79290).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNA Polymerase gamma Antibody (NBP1-79290) (0)
There are no reviews for DNA Polymerase gamma Antibody (NBP1-79290).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNA Polymerase gamma Antibody (NBP1-79290) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNA Polymerase gamma Products
Blogs on DNA Polymerase gamma