DLX5 Antibody (4C6) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH |
Specificity |
DLX5 (4C6) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
DLX5 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 10 ug/ml
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DLX5 Antibody (4C6)
Background
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for DLX5 Antibody (H00001749-M09) (0)
There are no publications for DLX5 Antibody (H00001749-M09).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DLX5 Antibody (H00001749-M09) (0)
There are no reviews for DLX5 Antibody (H00001749-M09).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DLX5 Antibody (H00001749-M09) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DLX5 Products
Research Areas for DLX5 Antibody (H00001749-M09)
Find related products by research area.
|
Blogs on DLX5