![Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in human liver.](http://images.novusbio.com/fullsize/DLST-Antibody-Western-Blot-H00001743-B01P-img0003.jpg "Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | DLST (NP_001924.2, 1 a.a. - 453 a.a.) full-length human protein. MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
| Specificity | DLST-dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | DLST |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLST |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: DLST Antibody [H00001743-B01P] - Analysis of purified antibody to DLST on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/DLST-Antibody-Immunocytochemistry-Immunofluorescence-H00001743-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: DLST Antibody [H00001743-B01P] - Analysis of purified antibody to DLST on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in HepG2.](http://images.novusbio.com/fullsize/DLST-Antibody-Western-Blot-H00001743-B01P-img0002.jpg "Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in HepG2.")
![Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in transfected 293T cell line by DLST polyclonal antibody. Lane 1: DLST transfected lysate(49.83 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/DLST-Antibody-Western-Blot-H00001743-B01P-img0004.jpg "Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in transfected 293T cell line by DLST polyclonal antibody. Lane 1: DLST transfected lysate(49.83 KDa). Lane 2: Non-transfected lysate.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")