DHX34 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GVCFRLYAESDYDAFAPYPVPEIRRVALDSLVLQMKSMSVGDPRTFPFIEPPPPASLETAILYLRDQGALDSSEALTPIGSLLAQLPVDVV |
Predicted Species |
Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DHX34 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for DHX34 Antibody
Background
DHX34, also known as Probable ATP-dependent RNA helicase DHX34, is a 128.1 kDa 1,143 amino acid protein that is utilized in a number of cellular processes, such as transcription and translation, as a member of the DEAD box protein family. Current research is exploring the use of the protein with diseases such as asthma and dermatitis. The protein interacts with RPS6KA6, POLA2, UBC, and GSK3B in ATP-binding pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Gp, Ha, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB (-)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Publications for DHX34 Antibody (NBP1-91833) (0)
There are no publications for DHX34 Antibody (NBP1-91833).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DHX34 Antibody (NBP1-91833) (0)
There are no reviews for DHX34 Antibody (NBP1-91833).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DHX34 Antibody (NBP1-91833) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DHX34 Products
Blogs on DHX34