Does Novus offer any CAD (caspase activated DNase) antibodies that specifically look at the activation state of CAD? And if so, how well does this antibody work with chicken?

Name: DFF40/CAD Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-55648PEP
Price: 279 USD

Question

Accepted Answer

CAD/DFF40/DFFB is inhibited by being bound by DFFA. Because of this manner of inhibition, antibodies will not be able to recognize the difference between activated and inhibited DFFB, so we do not have a product specifically for activated or inhibited DFFB and this product will probably be nearly impossible to make. Unfortunately, the human and chicken sequence appear to be divergent for any of our immunogens to recommend any antibody to test for cross-reactivity with chicken. I apologize for the inconvenience.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	AC

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DFF40/CAD. Source: E. coli Amino Acid Sequence: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DFFB
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55648. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

DFF40/CAD Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DFF40/CAD Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DFF40/CAD Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP) (0)

Reviews for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP) (0)

FAQs for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP). (Showing 1 - 1 of 1 FAQ).

Additional DFF40/CAD Products

Research Areas for DFF40/CAD Recombinant Protein Antigen (NBP2-55648PEP)

Blogs on DFF40/CAD

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics