![Western Blot: CYREN Antibody [NBP1-82120] - Analysis in control (vector only transfected HEK293T lysate) and C7orf49 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CYREN-Antibody-Western-Blot-NBP1-82120-img0007.jpg "Western Blot: CYREN Antibody [NBP1-82120] - Analysis in control (vector only transfected HEK293T lysate) and C7orf49 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYREN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CYREN Antibody [NBP1-82120] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CYREN-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82120-img0006.jpg "Immunocytochemistry/Immunofluorescence: CYREN Antibody [NBP1-82120] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human pancreas shows no postivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/CYREN-Antibody-Immunohistochemistry-Paraffin-NBP1-82120-img0011.jpg "Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human pancreas shows no postivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CYREN-Antibody-Immunohistochemistry-Paraffin-NBP1-82120-img0009.jpg "Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize/CYREN-Antibody-Immunohistochemistry-Paraffin-NBP1-82120-img0008.jpg "Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human cerebral cortex shows strong positivity in neuropil.")
![Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human prostate shows moderate to strong cytoplasmic postivity in glandualr cells.](http://images.novusbio.com/fullsize/CYREN-Antibody-Immunohistochemistry-Paraffin-NBP1-82120-img0010.jpg "Immunohistochemistry-Paraffin: CYREN Antibody [NBP1-82120] - Staining of human prostate shows moderate to strong cytoplasmic postivity in glandualr cells.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")