Cyclophilin 40 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPID. Source: E. coli
Amino Acid Sequence: IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
PPID |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85364. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Cyclophilin 40 Recombinant Protein Antigen
Background
Immunophilins are a family of soluble cytosolic receptors capable of binding to one of two major immunosuppressant agents: cyclosporin A (CsA) or FK506. Proteins that bind FK506 are termed FK506 Binding Proteins (FKBPs) and those that bind cyclosporin A are called cyclophilins (CyP). Both CyP:CsA and FKBP:FK506 complexes have been shown to inhibit calcineurin, a calcium and calmodulin dependent protein phosphatase which has been implicated as an important signaling enzyme in T-cell activation, providing a possible mechanism of immunosuppression by CsA and FK506. Immunophilins function as peptidyl prolyl cis-trans-isomerases (PPIase) whose activity is inhibited by their respective immunosuppressant compounds. As PPIase's, immunophilins accelerate folding of some proteins both in vivo and in vitro by catalyzing slow steps in the initial folding and rearrangement of proline containing proteins. CyP 40, a 40 kDa protein, shares significant homology with smaller CyPA (CyP 18) and FKBP59. CyP 40 exhibits the characteristic CsA binding and isomerase activity of CyP 18, though these activities appear to be less with CyP 40 than with Cyp 18. Like FKBP59, CyP 40 has been found in progesterone receptor complexes. CyP 40 is expressed at similar levels in many tissues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KO, WB
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
Species: Hu
Applications: AC
Publications for Cyclophilin 40 Protein (NBP1-85364PEP) (0)
There are no publications for Cyclophilin 40 Protein (NBP1-85364PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cyclophilin 40 Protein (NBP1-85364PEP) (0)
There are no reviews for Cyclophilin 40 Protein (NBP1-85364PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cyclophilin 40 Protein (NBP1-85364PEP) (0)
Additional Cyclophilin 40 Products
Research Areas for Cyclophilin 40 Protein (NBP1-85364PEP)
Find related products by research area.
|
Blogs on Cyclophilin 40