![Western Blot: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Analysis of extracts of various cell lines, using Cyclin B1 antibody (NBP3-15626) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-1Q3E9-Western-Blot-NBP3-15626-img0003.jpg "Western Blot: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Analysis of extracts of various cell lines, using Cyclin B1 antibody (NBP3-15626) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, KO |
| Clone | 1Q3E9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 3-177 of human Cyclin B1 (P14635). LRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CCNB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin B1 Antibody (NBP3-15626)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCNB1 |
![Immunohistochemistry-Paraffin: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Human colon carcinoma using [KO Validated] Cyclin B1 Rabbit mAb (NBP3-15626) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-1Q3E9-Immunohistochemistry-Paraffin-NBP3-15626-img0002.jpg "Immunohistochemistry-Paraffin: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Human colon carcinoma using [KO Validated] Cyclin B1 Rabbit mAb (NBP3-15626) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Knockout Validated: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Western blot analysis of extracts from normal (control) and Cyclin B1 knockout (KO) HeLa cells, using Cyclin B1 antibody (NBP3-15626) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-1Q3E9-Knockout-Validated-NBP3-15626-img0001.jpg "Knockout Validated: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Western blot analysis of extracts from normal (control) and Cyclin B1 knockout (KO) HeLa cells, using Cyclin B1 antibody (NBP3-15626) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![Immunoprecipitation: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Analysis of 300ug extracts of HeLa cells using 3ug Cyclin B1 antibody (NBP3-15626). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (NBP3-15626) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/Cyclin-B1-Antibody-1Q3E9-Immunoprecipitation-NBP3-15626-img0004.jpg "Immunoprecipitation: Cyclin B1 Antibody (1Q3E9) [NBP3-15626] - Analysis of 300ug extracts of HeLa cells using 3ug Cyclin B1 antibody (NBP3-15626). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (NBP3-15626) at a dilition of 1:1000.")
![Western Blot CDC25C Antibody (461908) [Unconjugated]](https://images.novusbio.com/images2/CDC25C_MAB4459_Western_Blot_6183.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")