![Western Blot: CYBB/NOX2 Antibody [NBP2-38642] - Analysis in human cell line NB4.](http://images.novusbio.com/fullsize/CYBB-NOX2-Antibody-Western-Blot-NBP2-38642-img0007.jpg "Western Blot: CYBB/NOX2 Antibody [NBP2-38642] - Analysis in human cell line NB4.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYBB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
Secondary Antibodies |
Isotype Controls |
Research Areas for CYBB/NOX2 Antibody (NBP2-38642)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Analysis in human spleen and skin tissues using NBP2-38642 antibody. Corresponding CYBB/NOX2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CYBB-NOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-38642-img0006.jpg "Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Analysis in human spleen and skin tissues using NBP2-38642 antibody. Corresponding CYBB/NOX2 RNA-seq data are presented for the same tissues.")
![Western Blot: CYBB/NOX2 Antibody [NBP2-38642] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize/CYBB-NOX2-Antibody-Western-Blot-NBP2-38642-img0002.jpg "Western Blot: CYBB/NOX2 Antibody [NBP2-38642] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG")
![Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/CYBB-NOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-38642-img0003.jpg "Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/CYBB-NOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-38642-img0004.jpg "Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Staining of human spleen shows high expression.")
![Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Staining in human spleen and skeletal muscle tissues using anti-CYBB antibody. Corresponding CYBB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CYBB-NOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-38642-img0005.jpg "Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP2-38642] - Staining in human spleen and skeletal muscle tissues using anti-CYBB antibody. Corresponding CYBB RNA-seq data are presented for the same tissues.")
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")