Home » CRB1 » CRB1 Proteins » CRB1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CRB1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CRB1 Recombinant Protein Antigen (NBP2-56113PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CRB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRB1.

Source: E. coli

Amino Acid Sequence: LLLALENSTYQYIRVWLERGRLAMLTPNSPKLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56113.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRB1 Recombinant Protein Antigen

  • crumbs homolog 1 (Drosophila)
  • LCA8

Background

CRB1, also known as Protein crumbs homolog 1, contains several isoforms that are 154 kDa, 151 kDa, 142 kDa, 104 kDa, and 95 kDa, and is involved in the development of photoreceptors in the retina. Defects and mutations in the CRB1 protein result in a variety of disorders, and more research is currently being conducted on the protein's relation to other diseases, including pigmented paravenous chorioretinal atrophy, cone-rod dystrophy, Stargardt disease, keratoconus, retinal degeneration, hyperopia, tuberous sclerosis, and blindness. The protein is linked to epithelial tight junction pathways, and interacts with INADL, MPP5, PSMD13, PRKAR1A, and DDX56.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GUCY2D Antibody
NBP3-12211
Immunohistochemistry-Paraffin GUCY2D Antibody
Unknown GUCY2D Antibody
Western Blot GUCY2D Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(97 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
PALS1/MPP5 Antibody
AF7979
Western Blot PALS1/MPP5 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
AIPL1 Antibody
(OTI3B4)
NBP2-01327
Flow Cytometry AIPL1 Antibody (OTI3B4)
Western Blot AIPL1 Antibody (OTI3B4)
Immunohistochemistry-Paraffin AIPL1 Antibody (OTI3B4)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CRX/CORD2 Antibody
(4G11)
H00001406-M02
Western Blot CRX/CORD2 Antibody (4G11)
Immunocytochemistry/ Immunofluorescence CRX/CORD2 Antibody (4G11)
ELISA CRX/CORD2 Antibody (4G11)
(32 Publications)
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
RPGRIP1 Antibody
NBP2-55753
Immunohistochemistry-Paraffin RPGRIP1 Antibody
Immunohistochemistry-Paraffin RPGRIP1 Antibody
Immunohistochemistry-Paraffin RPGRIP1 Antibody
Species: Hu
Applications: IHC, IHC-P
Clathrin light
chain + heavy chain A ...
NBP1-05035
Western Blot Clathrin light chain + heavy chain Antibody
Immunohistochemistry-Paraffin Clathrin light chain + heavy chain Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
RDH12 Antibody
(1E11)
H00145226-M01
Sandwich ELISA RDH12 Antibody (1E11)
Immunocytochemistry/ Immunofluorescence RDH12 Antibody (1E11)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
CRB2 Antibody
NBP1-91809
Immunohistochemistry-Paraffin CRB2 Antibody
Immunohistochemistry-Paraffin CRB2 Antibody
Immunohistochemistry-Paraffin CRB2 Antibody
Species: Hu
Applications: IHC, IHC-P
PATJ Antibody
NB100-1354
Immunofluorescence PATJ Antibody
Flow Cytometry PATJ Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
CRB3 Antibody
NBP1-81185
Immunocytochemistry/ Immunofluorescence CRB3 Antibody
Immunohistochemistry-Paraffin CRB3 Antibody
Immunohistochemistry-Paraffin CRB3 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
RPE Antibody
NBP1-56853
Western Blot RPE Antibody
Immunohistochemistry-Paraffin RPE Antibody
Species: Hu
Applications: IHC, IHC-P, WB
TULP1 Antibody
NBP1-31401
Immunocytochemistry/ Immunofluorescence TULP1 Antibody
Immunohistochemistry-Paraffin TULP1 Antibody
Western Blot TULP1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ABCA4 Antibody
(3F4)
NBP1-30032
Knockout Validated ABCA4 Antibody (3F4)
Immunohistochemistry ABCA4 Antibody (3F4)
Knockout Validated ABCA4 Antibody (3F4)
(1 Review)
(5 Publications)
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
CEP290 Antibody
NB100-86991
Western Blot CEP290 Antibody
Western Blot CEP290 Antibody
Immunocytochemistry/ Immunofluorescence CEP290 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Mer Antibody
[Unconjugated]
AF591
Flow Cytometry Mer Antibody [Unconjugated]
Immunohistochemistry Mer Antibody [Unconjugated]
Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]
(2 Reviews)
(71 Publications)
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
Lebercilin Antibody
NBP1-55416
Western Blot Lebercilin Antibody
(1 Publication)
Species: Hu
Applications: WB
SPATA7 Antibody
NBP1-83195
Immunocytochemistry/ Immunofluorescence SPATA7 Antibody
Immunohistochemistry-Paraffin SPATA7 Antibody
Immunohistochemistry-Paraffin SPATA7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CRB1 Recombinant
Protein Antigen
NBP2-56113PEP
CRB1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CRB1 Recombinant Protein Antigen (NBP2-56113PEP) (0)

There are no publications for CRB1 Recombinant Protein Antigen (NBP2-56113PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRB1 Recombinant Protein Antigen (NBP2-56113PEP) (0)

There are no reviews for CRB1 Recombinant Protein Antigen (NBP2-56113PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRB1 Recombinant Protein Antigen (NBP2-56113PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRB1 Products

Array NBP2-56113PEP

Research Areas for CRB1 Recombinant Protein Antigen (NBP2-56113PEP)

Find related products by research area.

Blogs on CRB1

There are no specific blogs for CRB1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: RPE65 Antibody (401.8B11.3D9) - BSA Free [NB100-355] - ICC-IF analysis of cultured ARPE19 cells, a spontaneously arising human retinal pigment epithelia cell line - 10 minutes fixation in 4% PFA, 10 minutes permeabilization in PBS containing 0.2% Triton X-100 (PBS-T), 1 hour blocking in 10% normal goat serum containing 1% BSA in PBS-T, 1:100 primary antibody dilution in PBS, ON 4C incubation.
RPE65 Antibody (401.8B11.3D9) - BSA Free
NB100-355
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Mer Antibody [Unconjugated]
AF591

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRB1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CRB1