Home » CPT1B » CPT1B Proteins » CPT1B Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CPT1B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CPT1B Recombinant Protein Antigen (NBP3-17029PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CPT1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPT1B

Source: E. coli

Amino Acid Sequence: VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CPT1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17029.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CPT1B Recombinant Protein Antigen

  • carnitine O-palmitoyltransferase 1, muscle isoform
  • carnitine O-palmitoyltransferase I, mitochondrial muscle isoform
  • Carnitine O-palmitoyltransferase I, muscle isoform
  • carnitine palmitoyltransferase 1B (muscle)
  • Carnitine palmitoyltransferase 1B
  • Carnitine palmitoyltransferase I-like protein
  • CPT I
  • CPT1B
  • CPT1M
  • CPT1-M
  • CPT1-MMCCPT1
  • CPTI
  • CPTI-M
  • EC 2.3.1
  • EC 2.3.1.21
  • FLJ55729
  • FLJ58750
  • KIAA1670
  • MCPT1
  • M-CPT1

Background

The protein encoded by the CPT1B gene, a member of the carnitine/choline acetyltransferase family, is the rate-controllingenzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the nettransport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variantsencoding different isoforms have been found for this gene, and read-through transcripts are expressed from theupstream locus that include exons from this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CPT1A Antibody
NB100-53791
Western Blot CPT1A Antibody
Western Blot CPT1A Antibody
Immunohistochemistry-Paraffin CPT1A Antibody
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
CPT2 Antibody
NBP1-85471
Immunocytochemistry/ Immunofluorescence CPT2 Antibody
Immunohistochemistry-Paraffin CPT2 Antibody
Immunohistochemistry-Paraffin CPT2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CHPT1 Antibody -
Azide and BSA Free
NBP2-92299
Western Blot CHPT1 Antibody - Azide and BSA Free
(1 Review)
Species: Hu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Chymase/CMA1/Mast
Cell Chymase Antibody ...
MAB4099
Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]
ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IP, WB
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
IL-9 [Unconjugated]
409-ML/CF
IL-9 [Unconjugated]
(11 Publications)
Species: Mu
Applications: BA
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(127 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Acetyl Coenzyme A
Carboxylase Beta Anti ...
NBP1-90274
Immunohistochemistry-Paraffin Acetyl Coenzyme A Carboxylase Beta Antibody
Immunohistochemistry-Paraffin Acetyl Coenzyme A Carboxylase Beta Antibody
Immunohistochemistry-Paraffin Acetyl Coenzyme A Carboxylase Beta Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Choline Kinase
beta [Unconjugated]
8184-CK
Choline Kinase beta [Unconjugated]
Species: Hu
Applications: EnzAct
PGC1 alpha
Antibody - BSA Free
NBP1-04676
Western Blot PGC1 alpha Antibody - BSA Free
Immunohistochemistry-Paraffin PGC1 alpha Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PGC1 alpha Antibody - BSA Free
(11 Reviews)
(275 Publications)
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB

Publications for CPT1B Recombinant Protein Antigen (NBP3-17029PEP) (0)

There are no publications for CPT1B Recombinant Protein Antigen (NBP3-17029PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT1B Recombinant Protein Antigen (NBP3-17029PEP) (0)

There are no reviews for CPT1B Recombinant Protein Antigen (NBP3-17029PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CPT1B Recombinant Protein Antigen (NBP3-17029PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPT1B Products

Research Areas for CPT1B Recombinant Protein Antigen (NBP3-17029PEP)

Find related products by research area.

Blogs on CPT1B

There are no specific blogs for CPT1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Vehicle or RU 486 (5 mg/kg) injected mice were presented with/without corticosterone (10 mg/kg) for 3 days. The expressions of peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha NBP1-04676) and NIX (BNIP3L NBP1-88558) were visualized via western blotting. Loading control is beta-actin. n = 5. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105/) licensed under a CC-BY license.
PGC1 alpha Antibody - BSA Free
NBP1-04676

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CPT1B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CPT1B