Home » COL4A6 » COL4A6 Proteins » COL4A6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

COL4A6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for COL4A6 Recombinant Protein Antigen (NBP2-56903PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

COL4A6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL4A6.

Source: E. coli

Amino Acid Sequence: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL4A6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56903.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COL4A6 Recombinant Protein Antigen

  • collagen alpha 6 type IV
  • collagen alpha-6(IV) chain
  • collagen IV, alpha-6 polypeptide
  • collagen of basement membrane, alpha-6
  • collagen, type IV, alpha 6
  • CXDELq22.3
  • DELXq22.3
  • dJ889N15.4 (Collagen Alpha 6(IV))
  • EC 2.7.7.8
  • MGC88184

Background

The COL4A6 gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes.Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation withanother type IV colla

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Collagen IV alpha5
Antibody - BSA Free
NBP2-92585
Western Blot Collagen IV alpha5 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
Tumstatin/COL4A3
Antibody - Azide and ...
NBP3-02967
Western Blot Tumstatin/COL4A3 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Tumstatin/COL4A3 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Tumstatin/COL4A3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
COL4A2 Antibody -
BSA Free
NBP2-92506
Western Blot COL4A2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
EDAR Antibody
[Unconjugated]
AF745
EDAR Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: Block, WB
Collagen IV
Antibody
NB120-6586
Immunohistochemistry-Paraffin Collagen IV Antibody
Immunohistochemistry-Paraffin Collagen IV Antibody
Immunohistochemistry-Paraffin Collagen IV Antibody
(7 Reviews)
(38 Publications)
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KO, SR Microscopy, WB
Collagen I Antibody
NB600-408
Immunohistochemistry-Paraffin Collagen I Antibody
Immunohistochemistry-Paraffin Collagen I Antibody
Immunohistochemistry-Paraffin Collagen I Antibody
(16 Reviews)
(298 Publications)
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
Desmin Antibody
AF3844
Immunohistochemistry Desmin Antibody
Immunohistochemistry Desmin Antibody
Immunocytochemistry/ Immunofluorescence Desmin Antibody
(2 Reviews)
(30 Publications)
Species: Hu, Mu
Applications: IHC
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
Myelin PLP Antibody
NBP1-87781
Immunohistochemistry-Paraffin Myelin PLP Antibody
Immunohistochemistry-Paraffin Myelin PLP Antibody
Immunohistochemistry-Paraffin Myelin PLP Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Calpain 6 Antibody
- BSA Free
NBP1-76937
Immunohistochemistry-Paraffin Calpain 6 Antibody - BSA Free
Western Blot Calpain 6 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calpain 6 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Filamin A Antibody
(4E10-1B2)
H00002316-M01
Western Blot Filamin A Antibody (4E10-1B2)
ELISA Filamin A Antibody (4E10-1B2)
Proximity Ligation Assay Filamin A Antibody (4E10-1B2)
(14 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
Radixin Antibody
(1D9)
H00005962-M06
Western Blot Radixin Antibody (1D9)
Immunohistochemistry Radixin Antibody (1D9)
Immunocytochemistry/ Immunofluorescence Radixin Antibody (1D9)
(7 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
CCL27/CTACK [HRP]
DCC270
N/A CCL27/CTACK [HRP]
N/A CCL27/CTACK [HRP]
(10 Publications)
Species: Hu
Applications: ELISA
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(110 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
COL4A6 Recombinant
Protein Antigen
NBP2-56903PEP
COL4A6 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for COL4A6 Recombinant Protein Antigen (NBP2-56903PEP) (0)

There are no publications for COL4A6 Recombinant Protein Antigen (NBP2-56903PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL4A6 Recombinant Protein Antigen (NBP2-56903PEP) (0)

There are no reviews for COL4A6 Recombinant Protein Antigen (NBP2-56903PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COL4A6 Recombinant Protein Antigen (NBP2-56903PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COL4A6 Products

Array NBP2-56903PEP

Blogs on COL4A6

There are no specific blogs for COL4A6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Balb/3T3 mouse embryonic fibroblast cell line stained with Collagen I antibody. IHC-P image submitted by a verified customer review.
Collagen I Antibody
NB600-408-0.1mg
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit Antibody [Unconjugated]
AF1356

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COL4A6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol COL4A6