CLECL1 Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the N terminal of CLECL1.
Peptide sequence MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIY. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CLECL1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
167 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for CLECL1 Antibody
Background
DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production.DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-504 AF518873.1 1-504 505-649 AW237307.1 1-145 c
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu
Applications: BA
Publications for CLECL1 Antibody (NBP1-54968) (0)
There are no publications for CLECL1 Antibody (NBP1-54968).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLECL1 Antibody (NBP1-54968) (0)
There are no reviews for CLECL1 Antibody (NBP1-54968).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLECL1 Antibody (NBP1-54968) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLECL1 Products
Blogs on CLECL1