Home » CLEC4D/CLECSF8 » CLEC4D/CLECSF8 Proteins » CLEC4D/CLECSF8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CLEC4D/CLECSF8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLEC4D/CLECSF8 Protein (NBP1-84445PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CLEC4D/CLECSF8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLEC4D.

Source: E. coli

Amino Acid Sequence: KLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLEC4D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84445.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLEC4D/CLECSF8 Recombinant Protein Antigen

  • CD368
  • CLEC4D
  • CLEC6
  • CLEC-6
  • CLECSF8
  • CLECSF8Mpcl
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 8
  • C-type lectin domain family 4 member D
  • C-type lectin domain family 4, member D
  • C-type lectin receptor
  • C-type lectin superfamily member 8
  • C-type lectin-like receptor 6
  • macrophage C-type lectin
  • MCL
  • MGC40078
  • Mpcl

Background

CLEC4D encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATP Citrate Lyase
Antibody
NBP1-90267
Immunocytochemistry/ Immunofluorescence ATP Citrate Lyase Antibody
Western Blot ATP Citrate Lyase Antibody
Western Blot ATP Citrate Lyase Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Lamin B Receptor
Antibody
H00003930-B01P
Western Blot Lamin B Receptor Antibody
Immunocytochemistry/ Immunofluorescence Lamin B Receptor Antibody
Immunohistochemistry-Paraffin Lamin B Receptor Antibody
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PKD2L1 Antibody
(4F9)
H00009033-M01
Western Blot PKD2L1 Antibody (4F9)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
VEGFR3/Flt-4
Antibody [Unconjugate
AF743
Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]
(3 Reviews)
(139 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CD5 Antibody
(OTI7A7) - Azide and ...
NBP2-70360
Western Blot CD5 Antibody (OTI7A7) - Azide and BSA Free
Flow Cytometry CD5 Antibody (OTI7A7) - Azide and BSA Free
Flow Cytometry CD5 Antibody (OTI7A7) - Azide and BSA Free
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
CLEC4E Antibody
(16E3) - BSA Free
NBP1-49311
Flow Cytometry CLEC4E Antibody (16E3) - BSA Free
Flow Cytometry CLEC4E Antibody (16E3) - BSA Free
Flow Cytometry CLEC4E Antibody (16E3) - BSA Free
(3 Publications)
Species: Hu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DC-SIGN/CD209
Antibody (120507) [Un ...
MAB161
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
(1 Review)
(47 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DCIR/CLEC4A
Antibody (111F8.04)
DDX0180P-100
Flow (Cell Surface) DCIR/CLEC4A Antibody (111F8.04)
Immunohistochemistry-Paraffin DCIR/CLEC4A Antibody (111F8.04)
Immunohistochemistry DCIR/CLEC4A Antibody (111F8.04)
(10 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(645 Publications)
Species: Mu
Applications: ELISA
CLEC4D/CLECSF8
Recombinant Protein A ...
NBP1-84445PEP
CLEC4D/CLECSF8 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CLEC4D/CLECSF8 Protein (NBP1-84445PEP) (0)

There are no publications for CLEC4D/CLECSF8 Protein (NBP1-84445PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC4D/CLECSF8 Protein (NBP1-84445PEP) (0)

There are no reviews for CLEC4D/CLECSF8 Protein (NBP1-84445PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLEC4D/CLECSF8 Protein (NBP1-84445PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLEC4D/CLECSF8 Products

Blogs on CLEC4D/CLECSF8

There are no specific blogs for CLEC4D/CLECSF8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
bEnd.3 cells, a mouse endothelioma cell line, was stained with Goat Anti-Mouse VEGFR3/Flt‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF743, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by PE-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
VEGFR3/Flt-4 Antibody [Unconjugated]
AF743

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLEC4D/CLECSF8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLEC4D