CKS1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CKS1. Peptide sequence: MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQ The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CKS1B |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for CKS1 Antibody
Background
CKS1B (Cyclin-dependent kinases regulatory subunit 1) is a 79 amino acid protein that binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. Depleting CKS1B in breast cancer cells has been shown to slow cell cycle progression and regulation of CKS1B may provide a potential cancer treatment option. Besides breast cancer, CKS1B plays a role in multiple myeloma, adenocarcinoma, mantle cell lymphoma , oral squamous cell carcinoma, squamous cell carcinoma, cholesteatoma, paracoccidioidomycosis, intrahepatic cholangiocarcinoma, hepatoblastoma, hepatocellular carcinoma, non-small cell lung carcinoma, gallbladder carcinoma, basal cell carcinoma, endometrial carcinoma, renal cell carcinoma and thyroid carcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for CKS1 Antibody (NBP2-88788) (0)
There are no publications for CKS1 Antibody (NBP2-88788).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CKS1 Antibody (NBP2-88788) (0)
There are no reviews for CKS1 Antibody (NBP2-88788).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CKS1 Antibody (NBP2-88788) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CKS1 Products
Research Areas for CKS1 Antibody (NBP2-88788)
Find related products by research area.
|
Blogs on CKS1